y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G082200.1
FamilyGH81
Protein PropertiesLength: 731 Molecular Weight: 81522.8 Isoelectric Point: 7.0719
ChromosomeChromosome/Scaffold: 01 Start: 8708003 End: 8710725
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81637040
  VLSDPSRFFSPNLLSSPLPTNSFFQNFTLKNGDQPEYIHPYLIKSADSSLSISYPSFFHNPSFIYQIFVPDLTIFATDKTTSTSDKSHIISSYSDLSLTL
  DIPSSNLRFFLVRGSPFLTCSVTGNTPISISTVHAILSFSSNSSLTKHTIKLNNGQTWIIYASSSISLNHSVSLITSGGFSGILRIAVLSDSDPTCESIL
  DQFCSCYPTSGDAVLTKPFCVEYKWEKKGWGDLLMLAHPLHLDILCKDYCDVKVLENFRYKSIDGDLVGIVGDSWVLKPHQVSVTWHSIKGVNEESYAEI
  VTALAKDVDALDSSAITTKSSYFYGKLIARAARLALIAEEVCFLDVIPAIRKFLKDTIEPWLDGTFNGNGFLYESKWGGIVTKQGSTDSGADFGFGVYND
  HHYHIGYFLYGIAVLTKIDPAWGRRYKPQAYSLVADFMNLGRRSNSNYPRVRCFDFYKLHSWAGGLTEFADGRNQESTSEAVNAYYSAALMGLAYGDTHL
  VATGSTLTALEIQAAQTWWHVKEGDNLYGEEFTRENRVVGVLWANKRDSGLWFAPPDWRECRLGIQLLPILPISEVLFSAIEFTRQLVNWTLPALGREGV
  GEGWKGFVYALEAIYDKESALEKIRNLSGHDDGNSLTNLLWW
Full Sequence
Protein Sequence     Length: 731     Download
MLKKLGRKVN TLITKPFKKP KKPPPKPSSP PPPPLPSPPM SPPMPQIPPK NYPFLFPKVQ    60
SSVLSDPSRF FSPNLLSSPL PTNSFFQNFT LKNGDQPEYI HPYLIKSADS SLSISYPSFF    120
HNPSFIYQIF VPDLTIFATD KTTSTSDKSH IISSYSDLSL TLDIPSSNLR FFLVRGSPFL    180
TCSVTGNTPI SISTVHAILS FSSNSSLTKH TIKLNNGQTW IIYASSSISL NHSVSLITSG    240
GFSGILRIAV LSDSDPTCES ILDQFCSCYP TSGDAVLTKP FCVEYKWEKK GWGDLLMLAH    300
PLHLDILCKD YCDVKVLENF RYKSIDGDLV GIVGDSWVLK PHQVSVTWHS IKGVNEESYA    360
EIVTALAKDV DALDSSAITT KSSYFYGKLI ARAARLALIA EEVCFLDVIP AIRKFLKDTI    420
EPWLDGTFNG NGFLYESKWG GIVTKQGSTD SGADFGFGVY NDHHYHIGYF LYGIAVLTKI    480
DPAWGRRYKP QAYSLVADFM NLGRRSNSNY PRVRCFDFYK LHSWAGGLTE FADGRNQEST    540
SEAVNAYYSA ALMGLAYGDT HLVATGSTLT ALEIQAAQTW WHVKEGDNLY GEEFTRENRV    600
VGVLWANKRD SGLWFAPPDW RECRLGIQLL PILPISEVLF SAIEFTRQLV NWTLPALGRE    660
GVGEGWKGFV YALEAIYDKE SALEKIRNLS GHDDGNSLTN LLWWVHSRGD ELEIQHGAEG    720
KYCWFTHYCH *                                                         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF21.0e-6251707719+
pfam03639Glyco_hydro_81056708701+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP42646.1017301752putative beta-glucan elicitor receptor [Brassica napus]
GenBankABB69784.10447301685beta-glucan-binding protein 4 [Medicago truncatula]
GenBankABD96863.105072961748hypothetical protein [Cleome spinosa]
RefSeqXP_002282971.1017301744PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305966.10447301690predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8165422913356250
DW5138442654677310
GR9264052633275890
ES816542796247020.031
ES816542736156764.6
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)