y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G082500.6
FamilyCE10
Protein PropertiesLength: 365 Molecular Weight: 41333.5 Isoelectric Point: 8.7831
ChromosomeChromosome/Scaffold: 01 Start: 8762721 End: 8769414
Descriptionprenylcysteine methylesterase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101243442e-39
  QVRRSIVYGDQPRNRLDLYLPINTNGPKPVVVFVTGGAWIIGYKAWGSLLGLQLAERDIIVACVDYRNFPQGTISDMVKDVSQGVSFVCNLIDRFGGDPN
  RIYLMGQSAGAHISACVLLEQAIKESRGESTTWSVSQIKAYFGLSGGYNLFNLVDHFHNRGLYRSIFLSIMEGEGSFEQFSPEVRIKDPRNREAASLLPP
  IKLFHGTSDYSIPSDARLECV
Full Sequence
Protein Sequence     Length: 365     Download
MASMSPPIHD LRQHDETATH FYLDVRCLIC RFLGFIFGTE TFGNHQQQQF PRKPENMERQ    60
SSFSRDLGHA AAETYLITRL TFTLLRYLGV GYRWYTRLVA LACYALLLMP GFLQVAYCYF    120
FSSQVRRSIV YGDQPRNRLD LYLPINTNGP KPVVVFVTGG AWIIGYKAWG SLLGLQLAER    180
DIIVACVDYR NFPQGTISDM VKDVSQGVSF VCNLIDRFGG DPNRIYLMGQ SAGAHISACV    240
LLEQAIKESR GESTTWSVSQ IKAYFGLSGG YNLFNLVDHF HNRGLYRSIF LSIMEGEGSF    300
EQFSPEVRIK DPRNREAASL LPPIKLFHGT SDYSIPSDAR LECVKLLPRM LRHLRGNASC    360
RRFC*                                                                420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00312Esterase_lipase6.0e-7139234110+
pfam07859Abhydrolase_35.0e-915424290+
pfam00135COesterase2.0e-10141242118+
COG2272PnbA8.0e-11139242118+
COG0657Aes7.0e-19126336220+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD96862.105934763351hypothetical protein [Cleome spinosa]
GenBankABK28542.104333946338unknown [Arabidopsis thaliana]
RefSeqNP_186890.204333946338unknown protein [Arabidopsis thaliana]
RefSeqNP_197090.205433858342ATPCME (PRENYLCYSTEINE METHYLESTERASE); prenylcysteine methylesterase [Arabidopsis thaliana]
RefSeqXP_002264962.105933952333PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pbl_D0.00000000312125135157A Chain A, Crystal Structure Of A Putative Thioesterase (Tm1040_2492) From Silicibacter Sp. Tm1040 At 1.79 A Resolution
PDB2pbl_C0.00000000312125135157A Chain A, Crystal Structure Of A Putative Thioesterase (Tm1040_2492) From Silicibacter Sp. Tm1040 At 1.79 A Resolution
PDB2pbl_B0.00000000312125135157A Chain A, Crystal Structure Of A Putative Thioesterase (Tm1040_2492) From Silicibacter Sp. Tm1040 At 1.79 A Resolution
PDB2pbl_A0.00000000312125135157A Chain A, Crystal Structure Of A Putative Thioesterase (Tm1040_2492) From Silicibacter Sp. Tm1040 At 1.79 A Resolution
PDB1lzl_A0.00000000513424362172A Chain A, Bacterial Heroin Esterase
Transmembrane Domains
StartEnd
94116
153175
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY280956300443410
DY288531289443300
DY270152275443160
DY282217271443120
FC918186266443070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.013G079100.2
Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)