y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G083400.1
FamilyGT4
Protein PropertiesLength: 837 Molecular Weight: 94418.7 Isoelectric Point: 7.6894
ChromosomeChromosome/Scaffold: 01 Start: 8827369 End: 8831426
Descriptionsucrose synthase 5
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45657330
  DRKKPIIFSMARLDTVKNLTGLTEWYGKNKRLRSLVNLVIVGAFFNPSKSKDREEMAEIKKMHALIEKYQLKGQIRWIAAQTDRNRNGELYRCIADTKGA
  FVQPALYEAFGLTVIEAMNCGLPTFATNQGGPAEIIVDGVSGFHINPTNGDESSNKIADFFEKCKTNPA
Full Sequence
Protein Sequence     Length: 837     Download
MTSTSTGKLS DSIADNIRNA LKQSQSYMKR CFSKYMEKGK RVLKAHELRD EFEKVMDDKN    60
ETLGTMFSSA QEAVVTPPYV TFAVRPTPGC WEFVKVNSVD LSDVKQISSA EYLKLKETIA    120
DENWSKDENA LEVDFEAFDF SMPKLTLASS IGKGLNFASK YITSKLSGSV DNAQPLVDYL    180
LSLEYQGEKL MINETLNTAA KLQLALIVAE VSLSDLPRDT PYQSIELRFK EWGFERGWGD    240
TVERVHETIR SLSEVLQAPD PQNLEKLFSK LPTIFKVVIF SPHGYFGQSD VLGLPDTGGQ    300
VVYILDQMRA MEEELVLKIK SQGLNIKPQI LVVTRLIPDA RGTKCNQERE SIIGTKYSQI    360
LRVPFRTETG ILRRWVSRFD IYPYLETFAQ DVTSKILDAM EGKPDLIIGN YTDGNLVSSL    420
VASKLGITQA TIAHALEKTK YEDSDIKWKE LDPKYHFSCQ FIADTISMNA ADFIIASTYQ    480
EIAGSKERPG QYESHAAFTL PGLCRVVSGI NVYDPKFNIA APGADQSVYF PYTETGKRFT    540
SFHPAIEELL YSKVDNDEHI GYLADRKKPI IFSMARLDTV KNLTGLTEWY GKNKRLRSLV    600
NLVIVGAFFN PSKSKDREEM AEIKKMHALI EKYQLKGQIR WIAAQTDRNR NGELYRCIAD    660
TKGAFVQPAL YEAFGLTVIE AMNCGLPTFA TNQGGPAEII VDGVSGFHIN PTNGDESSNK    720
IADFFEKCKT NPAYWNQFSA DGLKRINECY TWKIYANKVL NMGCMYGFWK QLNKDQKQAK    780
QRYIQAFYNL MFRNLVKNVP LASDETQQPD SKPADKPQPT PSTKRSQSRL QRLFGA*       840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02472sucr_P_syn_N1.0e-64276762497+
cd03800GT1_Sucrose_synthase1.0e-117276760485+
PLN00142PLN0014201810817+
TIGR02470sucr_synth028802783+
pfam00862Sucrose_synth012552548+
Gene Ontology
GO TermDescription
GO:0005985sucrose metabolic process
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27338.1018201833unnamed protein product [Vitis vinifera]
EMBLCBI35298.101383314864unnamed protein product [Vitis vinifera]
RefSeqXP_002267020.1018161822PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270861.101382914840PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327452.1058202813predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s29_H03280733810A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4
PDB3s29_G03280733810A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4
PDB3s29_F03280733810A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4
PDB3s29_E03280733810A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4
PDB3s29_D03280733810A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794519801128070
BU103683808128120
CX1090545951046970
FG2273164542747270
EX2764103594498060
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00099.3Aquca_034_00099.2Aquca_034_00099.1Aquca_011_00228.1Aquca_114_00017.1
Aquca_020_00040.3Aquca_020_00040.2Aquca_020_00040.1Aquca_002_01365.2Aquca_002_01365.1
Aquca_020_00566.4Aquca_020_00566.3Aquca_020_00566.2Aquca_020_00566.1Aquca_003_00666.4
Aquca_003_00666.2Aquca_003_00666.1Aquca_003_00666.3
Arabidopsis lyrata470477487943489859488935494980
316284484788910122493691
Arabidopsis thalianaAT1G04920.1AT5G11110.1AT4G10120.2AT4G10120.1AT5G20280.1
AT5G49190.1AT1G73370.2AT1G73370.1AT3G43190.1AT5G20830.2
AT5G20830.1AT5G37180.1AT4G02280.1
Brachypodium distachyonBradi2g58860.1Bradi3g20120.1Bradi4g21750.1Bradi3g06217.1Bradi1g30520.1
Bradi1g29570.1Bradi3g60687.1Bradi1g46670.3Bradi1g46670.1Bradi1g62957.1
Bradi1g60320.3Bradi1g60320.2Bradi1g60320.1Bradi1g20890.1
Brassica rapaBra015364Bra033195Bra009830Bra006090Bra002289
Bra020096Bra037432Bra003845Bra006578Bra002332
Bra015995Bra039502Bra036282
Carica papayaevm.model.supercontig_46.57evm.model.supercontig_142.9evm.model.supercontig_83.22evm.model.supercontig_217.19evm.model.supercontig_82.65
evm.model.supercontig_178.35evm.model.supercontig_50.160evm.TU.contig_29609.1
Capsella rubellaCarubv10008160mCarubv10000113mCarubv10000112mCarubv10025867mCarubv10019738m
Carubv10000208mCarubv10016702mCarubv10006192mCarubv10000249m
Chlamydomonas reinhardtiiCre12.g524000.t1.2
Citrus clementinaCiclev10004221mCiclev10007311mCiclev10018655mCiclev10007312mCiclev10004341m
Ciclev10007488mCiclev10007487mCiclev10007486mCiclev10007485mCiclev10007484m
Ciclev10007483mCiclev10007482mCiclev10007481mCiclev10007480mCiclev10010343m
Ciclev10011062mCiclev10018889mCiclev10019255mCiclev10024638m
Citrus sinensisorange1.1g001492morange1.1g002660morange1.1g001541morange1.1g001705morange1.1g002665m
orange1.1g001557morange1.1g003726morange1.1g003962morange1.1g003661morange1.1g003657m
orange1.1g003656morange1.1g003655morange1.1g003652morange1.1g003647morange1.1g003646m
orange1.1g003947morange1.1g002909morange1.1g036539morange1.1g006524morange1.1g005444m
orange1.1g003987morange1.1g003985morange1.1g003636morange1.1g003552morange1.1g003549m
orange1.1g003492morange1.1g005365m
Cucumis sativusCucsa.266070.1Cucsa.249370.2Cucsa.249370.1Cucsa.088480.1Cucsa.173660.1
Cucsa.112470.1Cucsa.142060.2Cucsa.142060.1Cucsa.096950.1
Eucalyptus grandisEucgr.H00041.1Eucgr.F02931.1Eucgr.C01715.1Eucgr.E03524.1Eucgr.E03528.1
Eucgr.C03205.1Eucgr.C03199.1Eucgr.C03201.1Eucgr.C03204.1Eucgr.K03505.1
Eucgr.J01640.3Eucgr.J01640.2Eucgr.J01640.1Eucgr.K02305.2Eucgr.K02305.1
Eucgr.H01094.2Eucgr.H01094.1Eucgr.C00769.1Eucgr.C03207.1Eucgr.F01010.1
Eucgr.H03515.1Eucgr.B01577.1Eucgr.H03496.1
Fragaria vescamrna06523.1-v1.0-hybridmrna31122.1-v1.0-hybridmrna31164.1-v1.0-hybridmrna11606.1-v1.0-hybridmrna07050.1-v1.0-hybrid
mrna12940.1-v1.0-hybridmrna11429.1-v1.0-hybridmrna31666.1-v1.0-hybridmrna11077.1-v1.0-hybridmrna09290.1-v1.0-hybrid
Glycine maxGlyma14g03300.1Glyma06g48200.1Glyma08g42140.1Glyma18g12890.1Glyma17g11820.1
Glyma13g23060.2Glyma13g23060.1Glyma04g12220.2Glyma15g16171.2Glyma15g16171.1
Glyma11g33240.1Glyma17g05067.2Glyma17g05067.1Glyma15g20180.3Glyma15g20180.2
Glyma15g20180.1Glyma13g17421.4Glyma13g17421.3Glyma13g17421.1Glyma09g08550.6
Glyma09g08550.5Glyma09g08550.4Glyma09g08550.1Glyma14g39070.1Glyma02g40740.1
Glyma19g40041.2Glyma19g40041.1Glyma03g37441.2Glyma03g37441.1Glyma16g34290.2
Glyma16g34290.1Glyma09g29710.1
Gossypium raimondiiGorai.011G155900.4Gorai.011G155900.3Gorai.011G155900.2Gorai.011G155900.1Gorai.009G262100.2
Gorai.009G262100.1Gorai.010G116100.2Gorai.010G116100.1Gorai.013G235900.1Gorai.004G292800.2
Gorai.004G292800.1Gorai.009G038000.7Gorai.009G038000.6Gorai.009G038000.4Gorai.009G038000.3
Gorai.009G038000.2Gorai.009G038000.1Gorai.013G222400.2Gorai.013G222400.1Gorai.001G017700.1
Gorai.007G047100.1Gorai.010G092300.5Gorai.010G092300.4Gorai.010G092300.3Gorai.010G092300.2
Gorai.010G092300.1Gorai.010G091800.2Gorai.010G091800.1Gorai.001G083400.4Gorai.001G083400.3
Gorai.001G083400.2Gorai.004G142700.3Gorai.004G142700.2Gorai.004G142700.1
Linum usitatissimumLus10016657Lus10038119Lus10008056Lus10041041Lus10022570
Lus10006184Lus10020506Lus10012454Lus10017984Lus10007372
Lus10020791Lus10001468Lus10041979Lus10013417Lus10010308
Lus10008206
Malus domesticaMDP0000288684MDP0000783676MDP0000256965MDP0000137330MDP0000306580
MDP0000288876MDP0000174537MDP0000293214MDP0000581406MDP0000161129
MDP0000250070MDP0000215889MDP0000277711MDP0000287311MDP0000872262
MDP0000415558MDP0000132527MDP0000293649MDP0000160578MDP0000204871
MDP0000126946MDP0000204870MDP0000212593MDP0000188551MDP0000138004
MDP0000252802
Manihot esculentacassava4.1_000839mcassava4.1_000827mcassava4.1_024105mcassava4.1_001415mcassava4.1_000867m
cassava4.1_000744mcassava4.1_001062mcassava4.1_000732mcassava4.1_002265mcassava4.1_001912m
cassava4.1_001871mcassava4.1_001867mcassava4.1_001864mcassava4.1_001874mcassava4.1_001283m
cassava4.1_027790mcassava4.1_002238mcassava4.1_001840mcassava4.1_026466m
Medicago truncatulaMedtr5g091340.1Medtr3g047380.1Medtr4g115620.1Medtr4g124660.4Medtr4g124660.3
Medtr4g124660.2Medtr4g124660.1Medtr3g064610.1Medtr5g076830.1Medtr1g088170.1
Medtr6g081120.1Medtr6g081200.1Medtr6g081180.1
Mimulus guttatusmgv1a000579mmgv1a000604mmgv1a000596mmgv1a000621mmgv1a001291m
mgv1a024320mmgv1a002736mmgv1a001481mmgv1a001207m
Oryza sativaLOC_Os01g69030.4LOC_Os01g69030.3LOC_Os01g69030.2LOC_Os01g69030.1LOC_Os11g12810.1
LOC_Os08g20660.2LOC_Os08g20660.1LOC_Os02g09170.2LOC_Os02g09170.1LOC_Os06g43630.1
LOC_Os02g58480.1LOC_Os04g24430.1LOC_Os04g17650.1LOC_Os06g09450.8LOC_Os06g09450.7
LOC_Os06g09450.6LOC_Os06g09450.5LOC_Os06g09450.4LOC_Os06g09450.3LOC_Os06g09450.2
LOC_Os06g09450.1LOC_Os03g22120.3LOC_Os03g22120.1LOC_Os03g28330.4LOC_Os03g28330.3
LOC_Os03g28330.2LOC_Os03g28330.1LOC_Os07g42490.2LOC_Os07g42490.1
Panicum virgatumPavirv00017689mPavirv00015422mPavirv00021568mPavirv00021567mPavirv00021566m
Pavirv00040314mPavirv00068375mPavirv00009592mPavirv00069185mPavirv00025176m
Pavirv00065876mPavirv00061751mPavirv00054750mPavirv00054749mPavirv00031455m
Pavirv00032661mPavirv00046633mPavirv00046632mPavirv00046631mPavirv00047139m
Pavirv00026880mPavirv00026879mPavirv00022656m
Physcomitrella patensPp1s66_227V6.1Pp1s131_107V6.1Pp1s120_66V6.1Pp1s28_394V6.2Pp1s28_394V6.1
Pp1s93_98V6.1Pp1s303_45V6.1
Phaseolus vulgarisPhvul.006G031700.1Phvul.005G002600.1Phvul.003G170100.1Phvul.009G250800.1Phvul.006G087300.1
Phvul.003G127500.1Phvul.009G223800.2Phvul.009G223800.1Phvul.008G241300.1Phvul.001G209600.2
Phvul.001G209600.1Phvul.004G142800.1
Picea abiesMA_10743g0010MA_103595g0010MA_10432412g0010MA_10427170g0010MA_10430807g0030
MA_319g0010MA_10432094g0010MA_113423g0010MA_27253g0010MA_10429251g0010
MA_127762g0010
Populus trichocarpaPotri.013G095500.2Potri.013G095500.1Potri.017G057800.1Potri.001G317600.1Potri.018G124700.4
Potri.018G124700.3Potri.018G124700.1Potri.018G124700.2Potri.018G025100.2Potri.018G025100.1
Potri.001G317600.2Potri.006G064300.2Potri.006G064300.1Potri.006G136700.2Potri.006G136700.1
Potri.015G029100.3Potri.015G029100.2Potri.015G029100.1Potri.018G063500.2Potri.018G063500.1
Potri.012G037200.2Potri.012G037200.1Potri.004G081300.2Potri.004G081300.1Potri.017G139100.3
Potri.017G139100.2Potri.017G139100.1Potri.002G202300.1Potri.014G126800.1
Prunus persicappa000622mppa000639mppa000636mppa000716mppa001573m
ppa001537mppa001535mppa017606mppa001845mppa001135m
ppa002723m
Ricinus communis28543.m00038429904.m00290330074.m00133629848.m00459929739.m003693
29660.m00076129951.m00014329726.m00408629986.m001646
Setaria italicaSi000130mSi025907mSi013170mSi013169mSi016229m
Si005825mSi005783mSi005845mSi020148mSi034293m
Si005882mSi005881mSi005880mSi005859mSi034282m
Si034281mSi034280mSi034279m
Selaginella moellendorffii1484192020591988268237
Sorghum bicolorSb03g043900.1Sb05g007310.1Sb09g028570.1Sb04g005720.1Sb10g025240.1
Sb10g031040.2Sb10g031040.1Sb01g035890.1Sb10g006330.3Sb10g006330.2
Sb10g006330.1Sb01g033060.1Sb04g038410.1
Thellungiella halophilaThhalv10006639mThhalv10028384mThhalv10012643mThhalv10012540mThhalv10012539m
Thhalv10003667mThhalv10018094mThhalv10012719mThhalv10027639mThhalv10028457m
Thhalv10028435m
Vitis viniferaGSVIVT01020928001GSVIVT01037186001GSVIVT01012825001GSVIVT01035882001GSVIVT01034794001
GSVIVT01035106001GSVIVT01029388001GSVIVT01015018001GSVIVT01035210001GSVIVT01028043001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)