y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G088100.1
FamilyGT50
Protein PropertiesLength: 434 Molecular Weight: 50567.1 Isoelectric Point: 9.1894
ChromosomeChromosome/Scaffold: 01 Start: 9552826 End: 9556410
Descriptionmannosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT501284120
  IGTRGNCEPIVCAMILWIIICLNNGNVVQAAFWYGLIVHFRIYPIIYALPIIIFLDPRFFRSGTKPLLSDWTSDQGKAHQINSELTDKCVVCDALKSTFT
  RSRILFGLISGTVFLLCTGFFFRLYGWEFLHEALLYHLTRTDPRHNFSIYFYHIYLNYERELSVLEKLISFLPQFIVQLVLILCFAKDLVFCFFVQTVAF
  VAFNKVITAQYFVWFFCLLPLILPWSNMKLKWKGLCCILLWMGAQTHWLLWGYLLEFKGKNVFLQLWMASLLFLAANTFILIVLI
Full Sequence
Protein Sequence     Length: 434     Download
MISLKPRSIL LISAIFRVGL ILFGEWQDTH MEVRYTDVDY LVFSDAASLM ASGQSPYKRT    60
TYRYSPLLAF LLIPNSFTSR CWGKFLFSAS DLFVGLFIRI ILKQRKVPDD LCTYSMLIWL    120
FNPFAFTIGT RGNCEPIVCA MILWIIICLN NGNVVQAAFW YGLIVHFRIY PIIYALPIII    180
FLDPRFFRSG TKPLLSDWTS DQGKAHQINS ELTDKCVVCD ALKSTFTRSR ILFGLISGTV    240
FLLCTGFFFR LYGWEFLHEA LLYHLTRTDP RHNFSIYFYH IYLNYERELS VLEKLISFLP    300
QFIVQLVLIL CFAKDLVFCF FVQTVAFVAF NKVITAQYFV WFFCLLPLIL PWSNMKLKWK    360
GLCCILLWMG AQTHWLLWGY LLEFKGKNVF LQLWMASLLF LAANTFILIV LIRHHNYGPV    420
FRQHTDLKTT KTT*                                                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05007Mannosyl_trans2.0e-64128412287+
PLN02841PLN0284104423421+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP59446.1044321430PEANUT1 [Arabidopsis thaliana]
EMBLCBI36197.10314331410unnamed protein product [Vitis vinifera]
RefSeqNP_001132411.10742910434hypothetical protein LOC100193858 [Zea mays]
RefSeqNP_680199.10443216445PNT1 (PEANUT 1); alpha-1,4-mannosyltransferase/ mannosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002280567.1074334437PREDICTED: hypothetical protein [Vitis vinifera]
Transmembrane Domains
StartEnd
85102
112130
137159
164182
231253
302321
328350
390412
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES792886243572990
FC9246592431453870
EH6856972741394120
DY27891925112510
ES7928861092723740.08
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00057.1Aquca_027_00011.1Aquca_035_00139.1Aquca_027_00005.1Aquca_083_00090.1
Aquca_027_00008.1Aquca_083_00081.1Aquca_008_00278.1
Arabidopsis lyrata910198
Arabidopsis thalianaAT5G22130.2AT5G22130.1
Brachypodium distachyonBradi4g38200.1
Brassica rapaBra020174
Carica papayaevm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.364.444evm.model.supercontig_9.382.364.444
Capsella rubellaCarubv10000947m
Chlamydomonas reinhardtiiCre14.g616200.t1.2.125.281Cre14.g616200.t1.2.125.281Cre14.g616200.t1.2.354.469Cre14.g616200.t1.2.354.469
Citrus clementinaCiclev10001079m
Citrus sinensisorange1.1g012470morange1.1g020664morange1.1g014361m.155.293orange1.1g014361m.292.401orange1.1g014361m.292.401
orange1.1g014361m.155.293orange1.1g020629m
Cucumis sativusCucsa.099160.1
Eucalyptus grandisEucgr.H00040.1
Fragaria vescamrna23760.1-v1.0-hybrid
Glycine maxGlyma08g16980.1
Linum usitatissimumLus10000321Lus10013349
Malus domesticaMDP0000259191MDP0000246795MDP0000134018
Manihot esculentacassava4.1_033019m
Medicago truncatulaMedtr8g040610.1
Mimulus guttatusmgv1a006636mmgv1a019000mmgv1a018848m
Oryza sativaLOC_Os03g46750.1
Panicum virgatumPavirv00041326mPavirv00060844m
Physcomitrella patensPp1s171_137V6.1
Phaseolus vulgarisPhvul.005G043300.1
Picea abiesMA_10434160g0010
Populus trichocarpaPotri.001G031500.1Potri.001G031500.2
Prunus persicappa005934m
Ricinus communis30040.m000266
Setaria italicaSi029845m
Selaginella moellendorffii90874
Sorghum bicolorSb02g011300.1
Thellungiella halophilaThhalv10015361mThhalv10013575m
Vitis viniferaGSVIVT01017167001
Volvox carteriVocar20014433m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny