y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G121600.1
FamilyGT29
Protein PropertiesLength: 397 Molecular Weight: 45056.1 Isoelectric Point: 9.8968
ChromosomeChromosome/Scaffold: 01 Start: 14838478 End: 14839668
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291663750
  LMSSDNKYKSCAVVGNSGILLNTDHGKFIDGHEAVIRLNNARTERFEKNVGSKTSISFVNSNILHLCARRDGCFCHPYGGNVPMVMYICQPVHFMDYLVC
  NSSHKAPLLITDLRFDMLCARIVKYYSAKRFVEETGKALSEWGSTHDGSMFHYSSGMQAVMLALGICDKVSIFGFGKSTLAKHHYHTNQKAELRLHDYEA
  EYAFYHDLVK
Full Sequence
Protein Sequence     Length: 397     Download
MKRSFRPLIS ILMLVALAAT LSCRIAIRGG SGGGFAVSAE LETTRSRVLI QPPPIQNFNS    60
TLLKFAAVDT GEAKSKLEIE QLLEGSFAGQ GRYRTFATWR RFNHHDVKAR NSNGMPVMLR    120
SPKFYRYWLD FRRNLQHWAR KRMFQPDIMM DLVTLVKVPI DSHNGLMSSD NKYKSCAVVG    180
NSGILLNTDH GKFIDGHEAV IRLNNARTER FEKNVGSKTS ISFVNSNILH LCARRDGCFC    240
HPYGGNVPMV MYICQPVHFM DYLVCNSSHK APLLITDLRF DMLCARIVKY YSAKRFVEET    300
GKALSEWGST HDGSMFHYSS GMQAVMLALG ICDKVSIFGF GKSTLAKHHY HTNQKAELRL    360
HDYEAEYAFY HDLVKNPRAI PFISDKFRFP PVVFYQ*                             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_292.0e-30168375223+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15145.10133961384sialyltransferase-like protein [Gossypium raimondii]
EMBLCAN64919.1013961389hypothetical protein [Vitis vinifera]
RefSeqXP_002277132.1013961389PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306228.1013961390predicted protein [Populus trichocarpa]
RefSeqXP_002523786.10139646434sialyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wml_A0.00000000000312535656264A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
PDB2wnf_A0.00000000000612535656264A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
PDB2wnb_A0.00000000000612535656264A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO120268282122930
CU5391802311403700
GR710736200502490
DR9397892501483970
CN9480462161723870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi5g15097.1Bradi4g42490.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Fragaria vescamrna22044.1-v1.0-hybrid
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.004G009500.1Gorai.009G086400.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00003354mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Phaseolus vulgarisPhvul.011G093000.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny