y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G179800.1
FamilyAA3
Protein PropertiesLength: 750 Molecular Weight: 82136 Isoelectric Point: 7.2088
ChromosomeChromosome/Scaffold: 01 Start: 27564007 End: 27568110
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32347481.12104e-44
  DHNVFNIKCDVVIVGSGCGGGVAAAVLASSGQKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVGGGSAINWSASIKTPNNVL
  KEWSLDHKIPLFGSSEYENAMDAVYQRLGVTENCTEEGLQNQVLRKGCENLGLKVEAVPRNSPEDHYCGSCNLGCRTGDKKGTATTWLVDAQGYGAVILT
  ACKADRLMLVNNNEDARRRKKCLGVVATSLNKNLTKKLQFEAKTTISACGSLLTPPLMISSGLKNPNIGRNLHLHPALVAWGYFPEDETGIKGKSYEGGI
  ITSFNRIVSEESNNVHAIIQAPALGPASFAAISPWVSGRELKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIKYRLSEVDKENLKIGLRQVLRVLIAAGA
  VEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGLSSKDEYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMITIQS
  TSYCISNKIAQLLKK
Full Sequence
Protein Sequence     Length: 750     Download
MEIGNHETGD AHPLLRGGRR KTTYTHGFSS AQIQSLAAIC EALIPPLPLD SAHQASSLDA    60
FYKASGAEPP LPDEVAEMMV KRVVEPRVLS FVKVVLTVIS FRLGALLLCG WDCCDWKWPF    120
IHKFSELPVE RREKILMKWS SNGHHRLPLR AVFALIKTYC LFIFFSMLLK FVSQTDEKSE    180
NPSWKAIGYN VDKRQKRVSS PHGRKGIIET MHEDDSTFVQ SLTEKGLQVT EDPDHNVFNI    240
KCDVVIVGSG CGGGVAAAVL ASSGQKVVVI EKGNYFATTD YTSLEGPSMS ELYEYGGFLT    300
TTNGKFMIMA GSTVGGGSAI NWSASIKTPN NVLKEWSLDH KIPLFGSSEY ENAMDAVYQR    360
LGVTENCTEE GLQNQVLRKG CENLGLKVEA VPRNSPEDHY CGSCNLGCRT GDKKGTATTW    420
LVDAQGYGAV ILTACKADRL MLVNNNEDAR RRKKCLGVVA TSLNKNLTKK LQFEAKTTIS    480
ACGSLLTPPL MISSGLKNPN IGRNLHLHPA LVAWGYFPED ETGIKGKSYE GGIITSFNRI    540
VSEESNNVHA IIQAPALGPA SFAAISPWVS GRELKERMVR YPRLAHLFTL IRDQGSGEVM    600
EEGKIKYRLS EVDKENLKIG LRQVLRVLIA AGAVEVGTHR SDGQRIKCKG LTEESLQEFL    660
DNVPVVGGLS SKDEYWTLYL TAHQIGSCRM GATEEEGAVD ENGQSWEAEG LFVCDASVLP    720
TAIGVNPMIT IQSTSYCISN KIAQLLKKE*                                     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06970.00268373150+
PRK02106PRK021060.000868174364+
pfam05199GMC_oxred_C1.0e-20605732128+
COG2303BetA7.0e-22311749495+
pfam00732GMC_oxred_N1.0e-83289510225+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22878.10247481718alcohol oxidase [Glycine max]
EMBLCAN71289.10107484737hypothetical protein [Vitis vinifera]
EMBLCAP15763.1067494749long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
RefSeqXP_002285334.10107484737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002529832.10127488743electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.0000124172117499A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB2jbv_B0.0006430747225527A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism
PDB2jbv_A0.0006430747225527A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism
PDB3nne_H0.0006430747225527A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0006430747225527A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Transmembrane Domains
StartEnd
147169
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794753749107460
ES8092603701415090
HO7792244482126590
DW4835722772204960
ES8092601164205320.00000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.011G177100.3Gorai.011G177100.2Gorai.011G177100.1
Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)