y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G179800.3
FamilyAA3
Protein PropertiesLength: 666 Molecular Weight: 73182.9 Isoelectric Point: 7.7233
ChromosomeChromosome/Scaffold: 01 Start: 27564007 End: 27568110
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA31506647.00649e-45
  DHNVFNIKCDVVIVGSGCGGGVAAAVLASSGQKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVGGGSAINWSASIKTPNNVL
  KEWSLDHKIPLFGSSEYENAMDAVYQRLGVTENCTEEGLQNQVLRKGCENLGLKVEAVPRNSPEDHYCGSCNLGCRTGDKKGTATTWLVDAQGYGAVILT
  ACKADRLMLVNNNEDARRRKKCLGVVATSLNKNLTKKLQFEAKTTISACGSLLTPPLMISSGLKNPNIGRNLHLHPALVAWGYFPEDETGIKGKSYEGGI
  ITSFNRIVSEESNNVHAIIQAPALGPASFAAISPWVSGRELKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIKYRLSEVDKENLKIGLRQVLRVLIAAGA
  VEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGLSSKDEYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMITIQS
  TSYCISNKIAQLLKK
Full Sequence
Protein Sequence     Length: 666     Download
MMVKRVVEPR VLSFVKVVLT VISFRLGALL LCGWDCCDWK WPFIHKFSEL PVERREKILM    60
KWSSNGHHRL PLRAVFALIK TYCLFIFFSM TDEKSENPSW KAIGYNVDKR QKRVSSPHGR    120
KGIIETMHED DSTFVQSLTE KGLQVTEDPD HNVFNIKCDV VIVGSGCGGG VAAAVLASSG    180
QKVVVIEKGN YFATTDYTSL EGPSMSELYE YGGFLTTTNG KFMIMAGSTV GGGSAINWSA    240
SIKTPNNVLK EWSLDHKIPL FGSSEYENAM DAVYQRLGVT ENCTEEGLQN QVLRKGCENL    300
GLKVEAVPRN SPEDHYCGSC NLGCRTGDKK GTATTWLVDA QGYGAVILTA CKADRLMLVN    360
NNEDARRRKK CLGVVATSLN KNLTKKLQFE AKTTISACGS LLTPPLMISS GLKNPNIGRN    420
LHLHPALVAW GYFPEDETGI KGKSYEGGII TSFNRIVSEE SNNVHAIIQA PALGPASFAA    480
ISPWVSGREL KERMVRYPRL AHLFTLIRDQ GSGEVMEEGK IKYRLSEVDK ENLKIGLRQV    540
LRVLIAAGAV EVGTHRSDGQ RIKCKGLTEE SLQEFLDNVP VVGGLSSKDE YWTLYLTAHQ    600
IGSCRMGATE EEGAVDENGQ SWEAEGLFVC DASVLPTAIG VNPMITIQST SYCISNKIAQ    660
LLKKE*                                                               720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06970.00159964750+
PRK02106PRK021060.000659765964+
pfam05199GMC_oxred_C4.0e-21521648128+
COG2303BetA2.0e-22227665496+
pfam00732GMC_oxred_N5.0e-84205426225+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22878.10166456718alcohol oxidase [Glycine max]
EMBLCAN71289.10166474737hypothetical protein [Vitis vinifera]
EMBLCAP15763.10966590749long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
RefSeqXP_002285334.10166474737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002529832.10166481743electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.0000215763617498A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB2jbv_B0.0005346663225527A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism
PDB2jbv_A0.0005346663225527A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism
PDB3nne_H0.0006346663225527A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0006346663225527A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794753657126620
ES809260363644250
HO7792244481285750
DW4835722771364120
ES8092601163364480.00000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2Gorai.011G177100.1
Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)