y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G182200.1
FamilyGT47
Protein PropertiesLength: 1258 Molecular Weight: 139356 Isoelectric Point: 8.5624
ChromosomeChromosome/Scaffold: 01 Start: 27866544 End: 27873965
DescriptionSubtilase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT471814030
  QFAVDRPEWGIMGGKDHFLVAGRITWDFRRLSDEESDWGNKLLFLPAARNMSMLVVESSPWNANDFGIPYPTYFHPAKDEEVFIWQDRMRKLERKWLFSF
  AGAPRPGNPKSIRGQIINQCRNSKVCKLLECDFGESKCHSPSSIMQMFQSSLFCLQPQGDSYTRRSAFDSMLAGCIPVFFHPGSAYTQYTWHLPKNFTTY
  SVFIPEDDIRKRNVSIEERLSQI
Full Sequence
Protein Sequence     Length: 1258     Download
RRPVTLGPLE AMEKGSPKNQ QTRLCFLASL SAFFWILLLY FHFVVLGSSP TVEESITLQP    60
VKLESPLVNV ESVPSPVTDA RVEKEKPAPV KPVQDTAGEK VVPYPFMRAL RTVENKSDPC    120
GGRYIYVHKL PPRFNEDMLK ECRSLSLWTN MCKFTSNKGL GPPLENVEGV FENTGWYATN    180
QFAVDRPEWG IMGGKDHFLV AGRITWDFRR LSDEESDWGN KLLFLPAARN MSMLVVESSP    240
WNANDFGIPY PTYFHPAKDE EVFIWQDRMR KLERKWLFSF AGAPRPGNPK SIRGQIINQC    300
RNSKVCKLLE CDFGESKCHS PSSIMQMFQS SLFCLQPQGD SYTRRSAFDS MLAGCIPVFF    360
HPGSAYTQYT WHLPKNFTTY SVFIPEDDIR KRNVSIEERL SQISPEQVKI MRETVINLIP    420
RLIYADPRSK LETLRDAFDV AVQAVIDKVT RLRRNIIQGR TEYDNFVEEN SWKYDLLDEG    480
QREPCLNSLL PLQTTPPPTS SSPSNYLCLY FSMEPKLHLF FSALCFYLVS AYGNTLRTYI    540
VQLHPHGVTS SSFPTKFLWH LSFLDQTLSS EEDSSSRLLY SYGSAMEGFA ALLTETEIEL    600
LRGLPDVVAV RPDQLLQLQT TYSYKFLGLS STTDGAWVKS GFGRGTIIGV LDTGVWPESP    660
SFADQGMPPV PKRWRGMCQE GQNFKATSCN RKLIGARFFI KGHHVSSVPP SENMVDEYIS    720
PRDSSGHGTH TSSTAGGVSV PMASVLVCWF NGCYSSDILA AIDVAIVDGV DVLSLSLGGF    780
PLPLFDDSIA IGSFRAVEHG ISVICAAGNN GPIQSSVANI APWIATIGAS TLDRKFPAIV    840
RMGNGEYVYG ESLFPGKSLP IAEKELELVY VTGGNSGSEF CFRGSLPKEK VKGKMVVCDR    900
GVNGRAEKGV AVKEAGGAAM ILANTEINLE EDSVDAHVLP ATEIGYAEAV RLKTYMDTTS    960
HPRARIVFGG TVIGTSRAPE VAQFSARGPN LYDSTILKPD VIAPGVNIIA AWPQNLGPTG    1020
LPEDTRRVNF TVMSGTSMAC PHVSGIAALI HSAHPGWTPA AIKSAIMTSA DASDHRGKPI    1080
MDGSKPAAVF AIGAGHVNPN RAIDPGLIYD IKPDEYVIHL CTLGYTRSEI FTITHRNVSC    1140
SEKLKMNRGF SLNYPSISVA FKHGVKSKMI TRRLTNVGNP NSVYSVQVKP PEGVKVRVKP    1200
RRLIFKHINQ SLSYRIWVIS RKKTQTKKIS YAEGQLTWMN AHNSFHRVRS PISVTWK*      1260
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd07474Peptidases_S8_subtilisin_Vpr-like4.0e-339571102147+
cd04852Peptidases_S8_34.0e-35995107177+
pfam03016Exostosin1.0e-43119403331+
cd04852Peptidases_S8_33.0e-61616832239+
Gene Ontology
GO TermDescription
GO:0004252serine-type endopeptidase activity
GO:0006508proteolysis
GO:0016020membrane
GO:0042802identical protein binding
GO:0043086negative regulation of catalytic activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI37197.1011256561316unnamed protein product [Vitis vinifera]
RefSeqNP_563701.1051312571773SDD1 (STOMATAL DENSITY AND DISTRIBUTION); serine-type endopeptidase [Arabidopsis thaliana]
RefSeqXP_002269766.1011256611411PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301847.1058612571692predicted protein [Populus trichocarpa]
RefSeqXP_002526537.1051312571767Cucumisin precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vta_B062012551618A Chain A, Crystal Structure Of Cucumisin, A Subtilisin-Like Endoprotease From Cucumis Melo L
PDB3vta_A062012551618A Chain A, Crystal Structure Of Cucumisin, A Subtilisin-Like Endoprotease From Cucumis Melo L
PDB3i74_B062012521640C Chain C, Crystal Structure Of The Plant Subtilisin-Like Protease Sbt3 In Complex With A Chloromethylketone Inhibitor
PDB3i74_A062012521640C Chain C, Crystal Structure Of The Plant Subtilisin-Like Protease Sbt3 In Complex With A Chloromethylketone Inhibitor
PDB3i6s_B062012521640A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease Sbt3
Transmembrane Domains
StartEnd
2446
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8330082752094830
CX6679612712044740
EX1383372502344830
EV1174262482364830
CX2803812482114580
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00701.1Aquca_025_00047.1Aquca_038_00043.1Aquca_003_00092.1Aquca_013_00533.1
Aquca_030_00256.1
Arabidopsis lyrata480865901861359365902333493853
915506344960482210492611919476
339091893098920989
Arabidopsis thalianaAT2G29040.1AT2G20370.1AT5G41250.1AT1G63450.1AT2G32750.1
AT4G13990.1AT4G22580.1AT2G31990.1AT2G32740.1AT5G62220.1
AT1G68470.1
Brachypodium distachyonBradi1g75450.1Bradi3g28020.1Bradi3g28027.1Bradi1g13110.1Bradi3g28012.1
Bradi3g28006.1Bradi3g32980.1Bradi3g28040.1Bradi1g78280.1Bradi5g18940.1
Bradi5g18927.1Bradi3g47480.1Bradi4g40070.1
Brassica rapaBra036680Bra036467Bra022900Bra028388Bra035655
Bra028492Bra022874Bra027802Bra005627Bra038960
Bra005559Bra021811Bra010065Bra004310Bra021763
Bra013627
Carica papayaevm.model.supercontig_29.130evm.model.supercontig_8.309evm.model.supercontig_81.132evm.model.supercontig_157.42evm.model.supercontig_3.255
evm.model.supercontig_157.43evm.model.supercontig_74.20
Capsella rubellaCarubv10025159mCarubv10013229mCarubv10023021mCarubv10006479mCarubv10025252m
Carubv10021808mCarubv10007051mCarubv10025326mCarubv10004820mCarubv10028275m
Carubv10020285m
Citrus clementinaCiclev10020110mCiclev10004973mCiclev10006440mCiclev10004838mCiclev10004905m
Ciclev10004921mCiclev10006490m
Citrus sinensisorange1.1g007197morange1.1g012984morange1.1g045731morange1.1g046652morange1.1g011220m
orange1.1g012090morange1.1g016487morange1.1g047350m
Cucumis sativusCucsa.140650.1Cucsa.320620.1Cucsa.135930.1Cucsa.095020.1Cucsa.125430.1
Cucsa.251330.1Cucsa.104410.1Cucsa.115600.1
Eucalyptus grandisEucgr.E00459.1Eucgr.A01318.1Eucgr.B02354.1Eucgr.H00492.1Eucgr.H02673.1
Eucgr.D01858.1Eucgr.A02868.1Eucgr.H02667.1Eucgr.D00738.1Eucgr.H00343.1
Fragaria vescamrna08349.1-v1.0-hybridmrna06574.1-v1.0-hybridmrna29211.1-v1.0-hybridmrna32241.1-v1.0-hybridmrna02225.1-v1.0-hybrid
mrna32454.1-v1.0-hybridmrna06576.1-v1.0-hybridmrna13394.1-v1.0-hybridmrna06572.1-v1.0-hybridmrna16329.1-v1.0-hybrid
mrna16326.1-v1.0-hybridmrna06573.1-v1.0-hybridmrna16325.1-v1.0-hybrid
Glycine maxGlyma13g18940.3Glyma13g18940.2Glyma10g04640.1Glyma19g35210.3Glyma19g35210.2
Glyma03g32481.1Glyma17g02880.1Glyma18g00560.1Glyma11g36640.1Glyma18g52010.1
Glyma18g52000.2Glyma11g02640.1Glyma08g29110.2Glyma20g29030.2Glyma20g00760.1
Glyma07g37751.1
Gossypium raimondiiGorai.007G150100.1Gorai.003G169500.1Gorai.006G224200.1Gorai.004G211300.1Gorai.011G152000.1
Gorai.001G111200.1Gorai.011G152600.1Gorai.006G226500.1Gorai.008G283000.3Gorai.008G283000.2
Gorai.008G283000.1Gorai.007G009300.1Gorai.009G098600.1Gorai.005G266400.1Gorai.009G374500.1
Linum usitatissimumLus10022862Lus10024961Lus10007037Lus10000604Lus10028924
Lus10006694Lus10016532Lus10004341Lus10001578Lus10004967
Lus10007426Lus10010677Lus10001028Lus10027386Lus10031685
Lus10015022Lus10013701Lus10005566Lus10013700Lus10005567
Lus10003440
Malus domesticaMDP0000697213MDP0000669665MDP0000204575MDP0000224103MDP0000315108
MDP0000317620MDP0000775334MDP0000899392MDP0000186840MDP0000661731
MDP0000317931MDP0000317621MDP0000839295MDP0000306185MDP0000301100
MDP0000828513MDP0000951395MDP0000131360MDP0000130660MDP0000133266
MDP0000290571MDP0000322393MDP0000132843MDP0000630192
Manihot esculentacassava4.1_004268mcassava4.1_004031mcassava4.1_032775mcassava4.1_007677mcassava4.1_026371m
cassava4.1_007928mcassava4.1_022618mcassava4.1_025515mcassava4.1_021548mcassava4.1_033519m
cassava4.1_005862mcassava4.1_023212mcassava4.1_029120m
Medicago truncatulaMedtr7g098650.1Medtr4g119810.1Medtr3g084400.1Medtr5g055350.1Medtr5g010370.1
Medtr5g010350.1Medtr5g095940.1Medtr1g102430.1Medtr3g007840.1Medtr5g095950.1
Mimulus guttatusmgv1a025815mmgv1a025992mmgv1a006271mmgv1a023797mmgv1a021582m
mgv1a007352mmgv1a004562m
Oryza sativaLOC_Os03g05110.1LOC_Os10g32170.1LOC_Os03g05060.2LOC_Os03g05060.1LOC_Os03g05070.1
LOC_Os12g38450.1LOC_Os10g32160.1LOC_Os10g32080.1LOC_Os10g40559.1LOC_Os06g23420.2
LOC_Os06g23420.1LOC_Os04g48480.1LOC_Os10g32110.1LOC_Os12g12290.1
Panicum virgatumPavirv00052911mPavirv00016514mPavirv00047043mPavirv00048669mPavirv00034812m
Pavirv00004154mPavirv00053716mPavirv00013474mPavirv00004155mPavirv00005480m
Pavirv00064113mPavirv00040881mPavirv00057287mPavirv00002639mPavirv00049145m
Pavirv00052250mPavirv00050116mPavirv00058137mPavirv00027041mPavirv00013287m
Pavirv00004398mPavirv00043727mPavirv00065473mPavirv00037613mPavirv00043360m
Pavirv00010825mPavirv00004150mPavirv00045520mPavirv00002799m
Physcomitrella patensPp1s5_379V6.1Pp1s158_189V6.1Pp1s47_268V6.1Pp1s60_282V6.1Pp1s5_370V6.1
Pp1s88_148V6.1Pp1s530_2V6.1Pp1s530_5V6.1Pp1s81_221V6.1Pp1s36_237V6.1
Pp1s21_30V6.1Pp1s1_428V6.1Pp1s26_8V6.1Pp1s236_30V6.1Pp1s20_115V6.1
Pp1s512_4V6.1Pp1s3_407V6.2Pp1s3_407V6.1Pp1s1_374V6.1
Phaseolus vulgarisPhvul.007G153600.1Phvul.001G266100.1Phvul.003G104800.2Phvul.003G104800.1Phvul.007G063500.1
Phvul.008G017900.1Phvul.002G157100.1Phvul.003G006800.1Phvul.001G165300.1
Picea abiesMA_10434404g0030MA_9990400g0010MA_371148g0010MA_372623g0010MA_100374g0010
MA_290104g0010MA_73539g0010MA_13968g0020MA_96103g0010MA_5948g0010
MA_76602g0010.250.389MA_76602g0010.250.389MA_10435411g0010MA_28102g0010.178.308MA_28102g0010.178.308
MA_7543346g0010
Populus trichocarpaPotri.002G256200.2Potri.002G256200.1Potri.001G120800.1Potri.014G147800.1Potri.009G032500.1
Potri.001G105300.1Potri.001G321000.1Potri.012G130700.1Potri.015G132600.1Potri.001G382200.1
Potri.001G381900.1Potri.003G112200.1Potri.003G126000.1
Prunus persicappa002811mppa005908mppa024321mppa016857mppa018367m
ppa018375mppa004844mppa006308mppa007371mppa007598m
ppa003851mppa004838mppa017713mppa008689mppa017934m
ppa025271m
Ricinus communis30190.m01120329002.m00014928455.m00036930065.m00113829637.m000730
30065.m00114130147.m01416130065.m00113628223.m000097
Setaria italicaSi034744mSi038964mSi035153mSi039422mSi038531m
Si039200mSi025042mSi039123mSi039377mSi019878m
Si012021mSi035637mSi036091mSi024608mSi008588m
Si004223m
Selaginella moellendorffii1012371181338576912679964314
126225123197983663817126870
Sorghum bicolorSb01g020070.1Sb01g047270.1Sb01g020080.1Sb01g047290.1Sb01g020060.1
Sb01g047300.1Sb08g018880.1Sb01g047280.1Sb01g047310.1Sb06g026020.1
Sb06g026010.1Sb01g047315.1Sb01g050380.1Sb01g029520.1Sb08g007160.1
Thellungiella halophilaThhalv10001932mThhalv10016337mThhalv10017561mThhalv10017898mThhalv10024922m
Thhalv10016613mThhalv10025220mThhalv10028137mThhalv10005582mThhalv10027680m
Thhalv10018517mThhalv10023358m
Vitis viniferaGSVIVT01019767001GSVIVT01031644001GSVIVT01028435001GSVIVT01004778001GSVIVT01001277001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)