y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G212900.1
FamilyGT1
Protein PropertiesLength: 466 Molecular Weight: 52641.1 Isoelectric Point: 7.1454
ChromosomeChromosome/Scaffold: 01 Start: 42509113 End: 42511468
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11864522.7e-34
  PWLIGTQASRKARLKFWIRILDRLTSLRWLLLNSFPQEFIIHDDEYQEDDYIAPPHNNPIIFPVGPLTEPSLTTPKNPSFWKEDTSCLDWLDHQKPNSVI
  YISFGSWVSPIGEAKIKTLALTLQSLNRPFIWVLAKSWRHGLPNGYSDTVSKQGKLVLWAPQFQVLQHKAVGLYLTHCGWNSTMEAIQCRKRLLCYPMAG
  DQFVNCKYIVKVWKLGVKVKGLGQKDVEEAVKKVMKDEEMEERLRKIYNRTMGEETSSRVAGNLKAF
Full Sequence
Protein Sequence     Length: 466     Download
MGVQCITKKP KILLVPYPAQ GHVNPMLKLG LALLTHGLQP IIVTPEFIHR RIVANVDLND    60
YQVRFMSIPD GFSGEGPYDF FAIEKSMENI MPNHLETLLH ELDEDDNGTV VCMVIDLLAS    120
WAIQVATRCG IPAAGFWPAM QATYRLITSI PEMLQADLIS ETGCPRHDGT VSSLPGQPLL    180
STEDLPWLIG TQASRKARLK FWIRILDRLT SLRWLLLNSF PQEFIIHDDE YQEDDYIAPP    240
HNNPIIFPVG PLTEPSLTTP KNPSFWKEDT SCLDWLDHQK PNSVIYISFG SWVSPIGEAK    300
IKTLALTLQS LNRPFIWVLA KSWRHGLPNG YSDTVSKQGK LVLWAPQFQV LQHKAVGLYL    360
THCGWNSTME AIQCRKRLLC YPMAGDQFVN CKYIVKVWKL GVKVKGLGQK DVEEAVKKVM    420
KDEEMEERLR KIYNRTMGEE TSSRVAGNLK AFVLGLDQLQ QNSLH*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02152PLN021521.0e-3410394409+
PLN02410PLN024101.0e-3411394399+
PLN02555PLN025553.0e-3610394420+
PLN02173PLN021732.0e-368394405+
PLN02562PLN0256206452447+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD44605.1064413445hypothetical protein [Arabidopsis thaliana]
EMBLCBI27396.1084415430unnamed protein product [Vitis vinifera]
RefSeqNP_188864.1064413445UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana]
RefSeqXP_002266304.1084585447PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002521042.1074625454UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A074476464A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c9z_A8e-34110443113439A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1z_A8e-34110443113439A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1x_A8e-34110443113439A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A3e-316243268427A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO07889328012800
JG8576182052594630
DV1366092641343940
DV1374052591363910
DY28873033313310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00241.1
Arabidopsis lyrata359787898691
Arabidopsis thalianaAT3G22250.1
Brachypodium distachyonBradi5g16210.1Bradi3g49560.1
Brassica rapaBra031343Bra023841
Carica papayaevm.TU.contig_33896.1
Capsella rubellaCarubv10015270m
Citrus clementinaCiclev10011626m
Citrus sinensisorange1.1g011687m
Cucumis sativusCucsa.058490.1
Eucalyptus grandisEucgr.A00895.1Eucgr.A00894.1
Fragaria vescamrna24330.1-v1.0-hybrid
Glycine maxGlyma14g00550.1
Linum usitatissimumLus10031068
Malus domesticaMDP0000428660MDP0000804900
Manihot esculentacassava4.1_025922m
Medicago truncatulaMedtr5g098960.1
Mimulus guttatusmgv1a006836m
Oryza sativaLOC_Os04g44354.3LOC_Os04g44354.1LOC_Os02g42280.1
Panicum virgatumPavirv00063473mPavirv00056969mPavirv00014153mPavirv00005772mPavirv00010929m
Pavirv00022059mPavirv00056667m
Phaseolus vulgarisPhvul.008G291000.1
Populus trichocarpaPotri.016G019400.1
Prunus persicappa016262m
Ricinus communis30106.m000653
Setaria italicaSi009868mSi019167mSi033416m
Sorghum bicolorSb04g026870.1Sb06g023060.1Sb02g022240.1
Thellungiella halophilaThhalv10020711m
Vitis viniferaGSVIVT01010098001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny