y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G218100.4
FamilyGT19
Protein PropertiesLength: 383 Molecular Weight: 42934.5 Isoelectric Point: 9.787
ChromosomeChromosome/Scaffold: 01 Start: 43954755 End: 43958979
Descriptiontransferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT19303420
  VKLKETVEAALQFQPHVVVTVDSKGFSFRLLKQLRARYNQQRSDRPVLFHYVAPSFWAWKGGEARLKGLSKFVDYVFCILPNEEAGCKLNGLNATFVGHP
  ILEDVLELNMGKETALHEWKITGNGEDFRKKYAIASGATVITLLPGSRLQEVTRMLPIFSNTMKLLKDSFPELVTVIHVAPNQLVDNYIAKAVHKWPVPA
  ILIPGGTPQLKYDAFNASLVALCTSGTVAMELQLARLPCLVTYRAHFLTEWFVRHKAKIPYISLPNILLDSPVIPEALFQACTPAKVAFLLKELMNNTVL
  QQQQIAAAEKVME
Full Sequence
Protein Sequence     Length: 383     Download
MNLEDSLKKK KKKLCTKLLM DHLYLMKCQV KLKETVEAAL QFQPHVVVTV DSKGFSFRLL    60
KQLRARYNQQ RSDRPVLFHY VAPSFWAWKG GEARLKGLSK FVDYVFCILP NEEAGCKLNG    120
LNATFVGHPI LEDVLELNMG KETALHEWKI TGNGEDFRKK YAIASGATVI TLLPGSRLQE    180
VTRMLPIFSN TMKLLKDSFP ELVTVIHVAP NQLVDNYIAK AVHKWPVPAI LIPGGTPQLK    240
YDAFNASLVA LCTSGTVAME LQLARLPCLV TYRAHFLTEW FVRHKAKIPY ISLPNILLDS    300
PVIPEALFQA CTPAKVAFLL KELMNNTVLQ QQQIAAAEKV MELLCPPNRT LNNTEQQGMK    360
PSPPSYSPSM IAASTILSYK QR*                                            420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14089PRK140891.0e-1933299273+
TIGR00215lpxB1.0e-3433326296+
pfam02684LpxB4.0e-4333344314+
COG0763LpxB6.0e-6733335305+
PRK00025lpxB3.0e-7033344329+
Gene Ontology
GO TermDescription
GO:0008915lipid-A-disaccharide synthase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI28885.102438173430unnamed protein product [Vitis vinifera]
GenBankEEC71491.1019377106463hypothetical protein OsI_03760 [Oryza sativa Indica Group]
RefSeqNP_178535.2019382102455transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002458499.101938281443hypothetical protein SORBIDRAFT_03g034785 [Sorghum bicolor]
RefSeqXP_002528957.1024379111466Lipid-A-disaccharide synthase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC601543205892930
JG864023279433210
EX6864182591213790
EL9338232341163490
EY717263252202710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00075.3Aquca_006_00075.2Aquca_006_00075.1
Arabidopsis lyrata480096
Arabidopsis thalianaAT2G04560.1
Brachypodium distachyonBradi2g50040.1
Brassica rapaBra015155.41.173Bra015155.41.173Bra015155.191.448Bra015155.191.448
Carica papayaevm.model.supercontig_132.41
Capsella rubellaCarubv10016120m
Citrus clementinaCiclev10018214m
Citrus sinensisorange1.1g024872morange1.1g016179m
Cucumis sativusCucsa.139770.1
Eucalyptus grandisEucgr.K00731.1
Fragaria vescamrna01138.1-v1.0-hybrid
Glycine maxGlyma02g11180.1
Gossypium raimondiiGorai.001G218100.1Gorai.001G218100.5Gorai.001G218100.6Gorai.001G218100.3Gorai.001G218100.2
Linum usitatissimumLus10035357Lus10029959
Malus domesticaMDP0000254582MDP0000227552
Manihot esculentacassava4.1_026066m
Mimulus guttatusmgv1a006184m
Oryza sativaLOC_Os01g54900.1
Panicum virgatumPavirv00020712mPavirv00034263mPavirv00034264mPavirv00034262m
Physcomitrella patensPp1s51_278V6.2Pp1s51_278V6.1Pp1s51_297V6.1Pp1s98_156V6.1
Phaseolus vulgarisPhvul.003G026900.1
Picea abiesMA_10428134g0010MA_159001g0240MA_10297492g0010
Populus trichocarpaPotri.014G160300.1
Prunus persicappa026476m
Ricinus communis56517.m00002234198.m00002229620.m000548
Selaginella moellendorffii405438
Sorghum bicolorSb03g034785.1
Thellungiella halophilaThhalv10002525m
Vitis viniferaGSVIVT01030530001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny