y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G230200.1
FamilyCBM43
Protein PropertiesLength: 462 Molecular Weight: 51373 Isoelectric Point: 9.4023
ChromosomeChromosome/Scaffold: 01 Start: 46676120 End: 46678741
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433724551.4e-29
  WCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPSFGHCK
GH17243450
  VGVNYGQLGNNLPSPKQSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSP
  KDIWPNIVPAMRKIKKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDVYPYFAWVMDPKNINLEYALFESRTI
  KYTDPLSNLTYTNLFDQMVDSVVFAMKRLGYPDIRIWIAETGWPNAGDIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQKP
  GPGTERHFGLLYPNGTKIYGID
Full Sequence
Protein Sequence     Length: 462     Download
MALLPLYFFF LFLSVSSGEF SSQVGVNYGQ LGNNLPSPKQ SVKLIQSLGA KRVKIYDANH    60
DILNALKGTN LQVCIMVPNE IINNISTSQK LADSWVETNV VPFYSTTKIR YLLVGNEVIS    120
GSPKDIWPNI VPAMRKIKKS LKTHGLDKIK VSTSMAMDVL ESSFPPSNGT FRSDIADSIV    180
RPLLQFLHRT KSFYFLDVYP YFAWVMDPKN INLEYALFES RTIKYTDPLS NLTYTNLFDQ    240
MVDSVVFAMK RLGYPDIRIW IAETGWPNAG DIDQIGANIY NAATYNRNVV KKLTAKPPIG    300
TPARPGWVIP SLIFALYNEN QKPGPGTERH FGLLYPNGTK IYGIDLSGKT PDSCFEPLPK    360
PDNNEPYKGK IWCVAAKGVN ETALSSALSY ACSQGNKTCD PIQPGKKCFK PDSLFWHASY    420
AFSSYWSQSR KTGATCYFNG LATQTAKDPS FGHCKFPSVT L*                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X87.0e-1937244381+
smart00768X82.0e-3537245685+
pfam00332Glyco_hydro_172.0e-11724345323+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65039.101346114460putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
EMBLCBI39470.10646111467unnamed protein product [Vitis vinifera]
RefSeqNP_683538.101346114460glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002303070.1014615461predicted protein [Populus trichocarpa]
RefSeqXP_002334812.1014614465predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0243461312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0233471316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0233471316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0233471316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0233471316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5722513021084090
ES8063643511134570
ES815922282233040
ES8168552721914620
ES815922452973410.0000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)