y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G230200.3
FamilyCBM43
Protein PropertiesLength: 387 Molecular Weight: 43173.4 Isoelectric Point: 9.2575
ChromosomeChromosome/Scaffold: 01 Start: 46676441 End: 46678005
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM432973801.1e-29
  WCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPSFGHCK
GH1722700
  VPNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIA
  DSIVRPLLQFLHRTKSFYFLDVYPYFAWVMDPKNINLEYALFESRTIKYTDPLSNLTYTNLFDQMVDSVVFAMKRLGYPDIRIWIAETGWPNAGDIDQIG
  ANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERHFGLLYPNGTKIYGID
Full Sequence
Protein Sequence     Length: 387     Download
MVPNEIINNI STSQKLADSW VETNVVPFYS TTKIRYLLVG NEVISGSPKD IWPNIVPAMR    60
KIKKSLKTHG LDKIKVSTSM AMDVLESSFP PSNGTFRSDI ADSIVRPLLQ FLHRTKSFYF    120
LDVYPYFAWV MDPKNINLEY ALFESRTIKY TDPLSNLTYT NLFDQMVDSV VFAMKRLGYP    180
DIRIWIAETG WPNAGDIDQI GANIYNAATY NRNVVKKLTA KPPIGTPARP GWVIPSLIFA    240
LYNENQKPGP GTERHFGLLY PNGTKIYGID LSGKTPDSCF EPLPKPDNNE PYKGKIWCVA    300
AKGVNETALS SALSYACSQG NKTCDPIQPG KKCFKPDSLF WHASYAFSSY WSQSRKTGAT    360
CYFNGLATQT AKDPSFGHCK FPSVTL*                                        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X83.0e-1929736881+
smart00768X89.0e-3629738185+
pfam00332Glyco_hydro_172.0e-952270270+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65039.10138677460putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
EMBLCBI39470.10138681467unnamed protein product [Vitis vinifera]
RefSeqNP_683538.10138677460glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002334812.10138679465predicted protein [Populus trichocarpa]
RefSeqXP_002534357.1013861387Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0227154312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0227154306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0227154306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_D0227255316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_C0227255316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT572251302333340
ES806364351383820
ES8168552721163870
ES8203242741133860
EX291357356243770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)