y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G258600.2
FamilyGH38
Protein PropertiesLength: 976 Molecular Weight: 111983 Isoelectric Point: 7.1111
ChromosomeChromosome/Scaffold: 01 Start: 53302385 End: 53306892
Descriptiongolgi alpha-mannosidase II
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3833020
  RRRKFIWEEMSYLERWWRDASEDKRETFTNLVKNGQLEIVGGGWVMNDEANSHYFAIIEQITEGNMWLNDTIGFVPKNSWAIDPFGYSPTMAYLFRRMGF
  ENMLIQRTHYELKKELAWNKNLEYVWRQSWDANETTDIFVHMMPFYSYDIPHTCGPEPAICCQFDFARSHGFSYELCPWGQYPVETNPENVQERALKLLD
  QYRKKSTLYRTNTLLVPLGDDFRYVTAEEAEAQFRNYQMIFDYINSTPSLNAEAKFGTLDDYFQTLREEADRINYSVPREIGSGQISGFPSLSGDFFTYA
Full Sequence
Protein Sequence     Length: 976     Download
MDRRRKFIWE EMSYLERWWR DASEDKRETF TNLVKNGQLE IVGGGWVMND EANSHYFAII    60
EQITEGNMWL NDTIGFVPKN SWAIDPFGYS PTMAYLFRRM GFENMLIQRT HYELKKELAW    120
NKNLEYVWRQ SWDANETTDI FVHMMPFYSY DIPHTCGPEP AICCQFDFAR SHGFSYELCP    180
WGQYPVETNP ENVQERALKL LDQYRKKSTL YRTNTLLVPL GDDFRYVTAE EAEAQFRNYQ    240
MIFDYINSTP SLNAEAKFGT LDDYFQTLRE EADRINYSVP REIGSGQISG FPSLSGDFFT    300
YADRQKDYWS GYYVSRPFFK AVDRVLEQTL RASEMLMAFL LGHCQRPQCE KLPMRYAYKL    360
TAARRNLALF QHHDGVTGTA KDHVVLDYGT RMHTSLQDLQ IFMSKAIEVL LGIRQEKYDQ    420
TPALFDPEQV RSKYDALPMH RAISARKGTV QSVVLFNPLE QTREEVVMVV VSRPDVSVLD    480
SNWTCVQSQV SPELQHDESK IFTGRHRIHW KASIPAMGLQ TYYIANGFAG CEKAKPAKLK    540
FSSKLSSGPC LAPYACSKVE GDTVEIVNRH QVLTFDVKHG LLQKVIHKNG LQNVVVEEIA    600
LYSSSGGAYL FLPDGDAQPI IKSGGNLVIS EGPLMQEVYS YPKTSWEKTP VSHSTRIYNG    660
GNTVQDFLIE KEYHVELLGK DFNDRELIVR YKTDTNNKRI FYSDLNGFQM SRRETYDKIP    720
LQGNYYPMPS LAFMQGSNGQ RFSVHSRQAL GAASLKEGWL EIMLDRRLVR DDGRGLGQGV    780
MDNHVMNVVF HILMESNISS TSDPVSNPLP LSPSLLSHRV NAQLNYPLHA FIAKKPQEIS    840
APTHSRSFSP LAAPLPCDLH IVSFKVPRPS KYSQQQQQLV DPRLVLMLHR RNWDSSYCKK    900
ARSQCTAVAD ESVNLFNMFK DLTVLNARAT SLNLLHDDTE MLGYTEQFGD VARDGRVIIP    960
PMEIQAYKFE LRPRQ*                                                    1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00451GH38N_AMII_euk4.0e-892248248+
cd11667GH38N_Man2A29.0e-1292313312+
cd11666GH38N_Man2A11.0e-1382313312+
PLN02701PLN0270102972974+
cd10809GH38N_AMII_GMII_SfManIII_like02313312+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35021.1029731781056unnamed protein product [Vitis vinifera]
RefSeqNP_196999.1029751931173GMII (GOLGI ALPHA-MANNOSIDASE II); alpha-mannosidase [Arabidopsis thaliana]
RefSeqXP_002276468.1029731781149PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438145.1029732071178hypothetical protein SORBIDRAFT_10g008770 [Sorghum bicolor]
RefSeqXP_002517418.1029752081180mannosidase alpha class 2a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1hxk_A0689295953A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A0689295953A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A0689295953A Chain A, Golgi Alpha-Mannosidase Ii
PDB1ps3_A06892125983A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A06892125983A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW2258332746799520
FL714386273493210
CB662086281933730
FN761337250703190
DY9390752992375350
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1Gorai.006G000300.3
Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9Gorai.012G082700.8
Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3Gorai.012G082700.2
Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)