y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G265200.1
FamilyGT1
Protein PropertiesLength: 412 Molecular Weight: 46855.4 Isoelectric Point: 5.3197
ChromosomeChromosome/Scaffold: 01 Start: 54161411 End: 54163031
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12483951.9e-28
  LCLAEPELEPQKKPFWIQWLDQKLAQGCSVLYVAFGSQAEVSSEQLQQIAMGLQESKANFLWVLRKKESESILDEGFEEKVKGRGIVVKQWVDQRQILKY
  QCIEGFLSHCGWNSALESICYGVPILAWPMIAEQALNARMVVEEIKVG
Full Sequence
Protein Sequence     Length: 412     Download
MDTNSSKFSI HHVVLFPFMS KGHIIPILNL ARLLLRRGMA VTMFTTTGNR PFISESLADT    60
SVCIIDIPFP QNAPEIPPGV ESTDLLPSMS LFFSFCKATK QMQPMVEEKL QGLVQVQPVS    120
FMVSDGFLWW TLESATKFGL PRLVFSGMNQ FISCVSRAVF EDRLLDGAES DDELITVTRF    180
PWIKVTRNDF NTVMPNPNGP TMEVFIDQVK SMSNSLGFIV NSFYELEKVY IDNWNSEKIP    240
KVWCVGPLCL AEPELEPQKK PFWIQWLDQK LAQGCSVLYV AFGSQAEVSS EQLQQIAMGL    300
QESKANFLWV LRKKESESIL DEGFEEKVKG RGIVVKQWVD QRQILKYQCI EGFLSHCGWN    360
SALESICYGV PILAWPMIAE QALNARMVVE EIKVGWLRWL WQTVMDRLGR R*            420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03004PLN030041.0e-4213395404+
PLN02448PLN024484.0e-5412396413+
PLN02863PLN028632.0e-6712395407+
PLN02534PLN025343.0e-7412395409+
PLN03007PLN030079.0e-7712395411+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACB56926.101239514395glycosyltransferase UGT90A7 [Hieracium pilosella]
RefSeqXP_002298527.1013951397predicted protein [Populus trichocarpa]
RefSeqXP_002517353.101139510394UDP-glucosyltransferase, putative [Ricinus communis]
RefSeqXP_002517354.1013958402UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A4.06377e-441239510417A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A6.00036e-42123958403A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A6.00036e-42123958403A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A6.00036e-42123958403A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B2e-371339512396A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT56145731113110
DT54791928112810
DT55106527112710
DT56753026212620
GR70685924412440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00292.1Aquca_025_00293.1Aquca_002_00206.1Aquca_004_00007.1Aquca_004_00008.1
Aquca_004_00009.1Aquca_031_00060.1
Arabidopsis lyrata480568874994350625471154
Arabidopsis thalianaAT2G16890.2AT5G14860.1AT1G10400.1
Brachypodium distachyonBradi2g36325.1Bradi2g36297.1Bradi4g28210.1Bradi1g43760.1Bradi1g37120.1
Bradi2g08147.1
Brassica rapaBra006271Bra008734Bra013043Bra018440
Capsella rubellaCarubv10013583mCarubv10003019mCarubv10013609mCarubv10016193mCarubv10012329m
Carubv10016195m
Citrus clementinaCiclev10015105m
Citrus sinensisorange1.1g019791morange1.1g048238m
Cucumis sativusCucsa.158560.1Cucsa.158600.1
Eucalyptus grandisEucgr.A01139.1Eucgr.J03156.1Eucgr.J03158.1Eucgr.J03155.1Eucgr.J03157.1
Eucgr.J03154.1
Fragaria vescamrna08733.1-v1.0-hybridmrna28389.1-v1.0-hybrid
Glycine maxGlyma16g08060.1
Linum usitatissimumLus10022222Lus10022220Lus10022221Lus10026927Lus10026926
Lus10020124
Malus domesticaMDP0000575823MDP0000576836MDP0000159916MDP0000261158MDP0000296033
MDP0000800689MDP0000942526MDP0000691324MDP0000130487MDP0000203647
MDP0000865084
Manihot esculentacassava4.1_022533mcassava4.1_025192mcassava4.1_007045m
Mimulus guttatusmgv1a005626mmgv1a026899m
Oryza sativaLOC_Os06g39070.1LOC_Os09g16090.1LOC_Os09g16030.1LOC_Os09g21160.1LOC_Os04g24110.1
LOC_Os06g16000.1LOC_Os05g42040.1LOC_Os06g39080.1LOC_Os06g08830.1
Panicum virgatumPavirv00038352mPavirv00070294mPavirv00062203mPavirv00046074mPavirv00058520m
Pavirv00020575mPavirv00042658mPavirv00025139mPavirv00067592mPavirv00016340m
Pavirv00034420mPavirv00017568mPavirv00037090m
Physcomitrella patensPp1s15_417V6.2Pp1s15_417V6.1
Phaseolus vulgarisPhvul.007G048100.1Phvul.008G151900.1
Populus trichocarpaPotri.018G009000.1Potri.001G348100.1Potri.006G272600.1Potri.006G272500.2Potri.006G272500.1
Potri.018G008900.1Potri.005G036100.1
Prunus persicappa005107mppa023458mppa017646m
Ricinus communis29822.m00335529822.m003356
Setaria italicaSi033411mSi033010mSi006359mSi020900mSi006267m
Si006185m
Sorghum bicolorSb10g005950.1Sb02g022230.1Sb02g023640.1Sb02g023632.1Sb10g009810.1
Sb10g022980.1
Thellungiella halophilaThhalv10022679mThhalv10015356m
Vitis viniferaGSVIVT01016138001
Zea maysAC234524.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)