y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G268100.1
FamilyCE10
Protein PropertiesLength: 449 Molecular Weight: 49677.6 Isoelectric Point: 8.0108
ChromosomeChromosome/Scaffold: 01 Start: 54506444 End: 54510402
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101074380
  RRSSYAPSNVGAPRNDPRRSSLEGLNLRSDNNVYRGYSPSPQNCRKLPIMLQFHGGGWVSGSNESVANDYFCRRIAKLCDVIVIAVGYRLAPENKYPAAF
  EDGLKVLNWLAKQANLSECSKSMGSGARGVGSEFTKAEVQRHIVDTFGASVVEPWLAAHGDPSRCVLLGVSCGANIVDYVARKAVEAGKRLDPVKVVAQV
  LMYPFFIGNVPTQSEIKLANSYFYDKAMCLLAWKLFLPKEEFSLDHPAANPLISDRGPPLKFMPPTLTVVAEHDWMRDRAIAYSETLRKVNVDAPVLEYK
  DAVHEFATLDMLLKTPQAQACAEDIAIWVKKY
Full Sequence
Protein Sequence     Length: 449     Download
MPSVALKLYS VFFKFLLKHR LQNLIQNAID ESSNPYGVTT RPEESVSASN PSFTDGVATK    60
DIHIDPFTAL SIRIFLPDSS LSPPEQPDLK PNLRSSGNDD PNSHNHRRSS YAPSNVGAPR    120
NDPRRSSLEG LNLRSDNNVY RGYSPSPQNC RKLPIMLQFH GGGWVSGSNE SVANDYFCRR    180
IAKLCDVIVI AVGYRLAPEN KYPAAFEDGL KVLNWLAKQA NLSECSKSMG SGARGVGSEF    240
TKAEVQRHIV DTFGASVVEP WLAAHGDPSR CVLLGVSCGA NIVDYVARKA VEAGKRLDPV    300
KVVAQVLMYP FFIGNVPTQS EIKLANSYFY DKAMCLLAWK LFLPKEEFSL DHPAANPLIS    360
DRGPPLKFMP PTLTVVAEHD WMRDRAIAYS ETLRKVNVDA PVLEYKDAVH EFATLDMLLK    420
TPQAQACAED IAIWVKKYIS TRGHEFSY*                                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10162PRK101625.0e-614122181+
pfam00135COesterase1.0e-6138285166+
cd00312Esterase_lipase7.0e-7138280152+
COG0657Aes2.0e-39135432299+
pfam07859Abhydrolase_31.0e-61156413258+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB89022.1014341450CXE carboxylesterase [Actinidia deliciosa]
RefSeqNP_001030781.1014481428hydrolase [Arabidopsis thaliana]
RefSeqXP_002267088.1014481464PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002267130.1014481425PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002526925.1014481472conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A2e-31147415107331B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB2zsh_A2e-31147415107331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F1e-27153415112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E1e-27153415112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D1e-27153415112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT555368279773550
ES789976376864490
JK5155042681824490
DT54625428872940
DT555368273563820.000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.011G093200.1
Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny