y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G008200.2
FamilyGT10
Protein PropertiesLength: 371 Molecular Weight: 42007.7 Isoelectric Point: 8.1986
ChromosomeChromosome/Scaffold: 02 Start: 534217 End: 539728
Descriptionfucosyltransferase 11
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101503520
  DATFKLPKKSKAPSVHRSMESASYYEENNITQARRDGFEIVMTTSLSSDVPVGYFSWAEYDIMAPVIPKSEKALAAAFISNCMASNFRLEALMELEKENI
  KIDSYGRCHKNRDERVDKVEILKRYKFSLAFENSNEEDYVTEKFFQSLVAGSVPVVIGAPNIEDFAPSSDSYLHIKDLKDVRSIAEQMKYLAGNPDAYNR
  LLR
Full Sequence
Protein Sequence     Length: 371     Download
MPNLRGSRTH EGLPISDASP ISVSNKKRWS TLMPWLIALV VIAQLAFLGR LGNAKNATFF    60
HSWPELFRTQ HSSSGVKVAG VRNSGIRGLG GHRNSGVETC EEWLEREDTL VYSRDFNKDP    120
IWILISGDKE DFKTCAVNCS FRSNWSRKAD ATFKLPKKSK APSVHRSMES ASYYEENNIT    180
QARRDGFEIV MTTSLSSDVP VGYFSWAEYD IMAPVIPKSE KALAAAFISN CMASNFRLEA    240
LMELEKENIK IDSYGRCHKN RDERVDKVEI LKRYKFSLAF ENSNEEDYVT EKFFQSLVAG    300
SVPVVIGAPN IEDFAPSSDS YLHIKDLKDV RSIAEQMKYL AGNPDAYNRL LRDIHGTFTR    360
ILLTMRYEWV *                                                         420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_102.0e-40121349257+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL99370.101035213346alpha 1,3 fucosyltransferase [Medicago sativa]
GenBankAAL99371.1073529345alpha 1,3 fucosyltransferase [Medicago sativa]
EMBLCAB52254.1013525350Fuct c3 protein [Vigna radiata var. radiata]
EMBLCAI70373.1013524362alpha 1,3 fucosyltransferase [Populus alba x Populus tremula]
RefSeqXP_002313854.1013524363predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.00000002266353224310B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2nzy_B0.00000002266353224310B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2nzy_A0.00000002266353224310B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2nzx_C0.00000002266353224310B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2nzx_B0.00000002266353224310B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Transmembrane Domains
StartEnd
3254
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO788660292363220
GR925461257422980
CO072619258232800
FF685200263453070
CO0767161951583520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny