y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G013000.1
FamilyAA2
Protein PropertiesLength: 325 Molecular Weight: 35217.2 Isoelectric Point: 9.5631
ChromosomeChromosome/Scaffold: 02 Start: 847444 End: 849691
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2503080
  HFRSNPAIAPGLLRMHFHDCFVNGCDGSVLIDGPNTERKAVQNSLLRGFDVIDEAKAKLEAACPGVVSCADILALAARDSVVLTKGINWKVPTGRRDGKV
  SLQSEAAKLPGFTDSIESQKQQFARFGLNTQDLVTLVGGHTIGTAACLVFNYRLNNFTNGGPDPTINPSFLPQLRSLCPQNGNNFRRVDLDTGSANKFDT
  SFFTNLKNGRGVLESDQKLWTDASTRTFVQQFLGEKGVRKLNFGKEFAKSMVKMSNIGV
Full Sequence
Protein Sequence     Length: 325     Download
MEPSYIFLTM AVTLLSMPAT GFGQGTTRVG FYSKTCPRAE SIVKSTVESH FRSNPAIAPG    60
LLRMHFHDCF VNGCDGSVLI DGPNTERKAV QNSLLRGFDV IDEAKAKLEA ACPGVVSCAD    120
ILALAARDSV VLTKGINWKV PTGRRDGKVS LQSEAAKLPG FTDSIESQKQ QFARFGLNTQ    180
DLVTLVGGHT IGTAACLVFN YRLNNFTNGG PDPTINPSFL PQLRSLCPQN GNNFRRVDLD    240
TGSANKFDTS FFTNLKNGRG VLESDQKLWT DASTRTFVQQ FLGEKGVRKL NFGKEFAKSM    300
VKMSNIGVKT GSNSEIRRVC SAIN*                                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.000825328129+
cd00314plant_peroxidase_like2.0e-2941305281+
pfam00141peroxidase3.0e-6643191150+
cd00693secretory_peroxidase2.0e-16528323300+
PLN03030PLN0303007324321+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL73112.10732411327bacterial-induced peroxidase [Gossypium hirsutum]
GenBankACN97186.1063248324peroxidase [Populus trichocarpa]
DDBJBAE16616.1063245324peroxidase [Populus alba]
RefSeqXP_002512127.10732410328Cationic peroxidase 2 precursor, putative [Ricinus communis]
RefSeqXP_002528494.1013243324Cationic peroxidase 2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0313247304A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB1pa2_A0313247304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B0313246299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0313246299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3hdl_A0283243303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT468388257112670
CU60998532063250
CU57517032063250
GR92812420512050
CK264108276222960
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00892.1Aquca_007_00386.1Aquca_007_00388.1Aquca_022_00275.1
Arabidopsis lyrata870602919714919715496608494031
329078316625316622351860920775
Arabidopsis thalianaAT2G41480.1AT5G64110.1AT5G39580.1AT5G64120.1AT5G64100.1
AT4G25980.1AT1G77100.1AT5G39580.2
Brachypodium distachyonBradi2g04490.1Bradi4g22660.1Bradi4g40680.1
Brassica rapaBra000228Bra016930Bra024268Bra031934Bra024269
Bra028436Bra024267Bra013938Bra031933Bra015695
Bra008291
Carica papayaevm.model.supercontig_42.86evm.model.supercontig_468.4evm.model.supercontig_468.3evm.model.supercontig_75.24evm.model.supercontig_49.72
evm.model.supercontig_42.87evm.TU.contig_36964.1evm.model.supercontig_845.4
Capsella rubellaCarubv10023605mCarubv10007711mCarubv10026774mCarubv10026761mCarubv10027924m
Carubv10021650mCarubv10007281m
Citrus clementinaCiclev10008925mCiclev10001751mCiclev10003869m
Citrus sinensisorange1.1g020511morange1.1g045530morange1.1g019638morange1.1g041705m
Cucumis sativusCucsa.217820.1Cucsa.292700.1Cucsa.217830.1Cucsa.345800.1Cucsa.292740.1
Cucsa.292700.2
Eucalyptus grandisEucgr.I02673.1Eucgr.L02460.2Eucgr.L02460.1Eucgr.L02460.4Eucgr.L02460.3
Eucgr.G00658.1Eucgr.F04267.1Eucgr.L01488.1Eucgr.L02460.6Eucgr.L02460.5
Fragaria vescamrna13503.1-v1.0-hybridmrna10707.1-v1.0-hybridmrna31037.1-v1.0-hybridmrna02015.1-v1.0-hybridmrna10709.1-v1.0-hybrid
mrna17058.1-v1.0-hybrid
Glycine maxGlyma08g19170.1Glyma13g23620.2Glyma06g28890.1Glyma15g05810.1Glyma15g05820.1
Glyma08g19180.1Glyma08g19340.1Glyma15g05650.1Glyma1655s00200.1Glyma15g05831.1
Gossypium raimondiiGorai.012G141300.1Gorai.005G219200.1Gorai.005G219400.1Gorai.005G219100.1Gorai.009G017700.2
Gorai.009G017700.1Gorai.012G141500.1Gorai.012G141500.2Gorai.002G208800.1
Linum usitatissimumLus10007051Lus10012684Lus10007052Lus10020826Lus10015555
Lus10028631Lus10020421Lus10007050Lus10018929
Malus domesticaMDP0000298078MDP0000198353MDP0000184865MDP0000299137MDP0000515971
MDP0000684133MDP0000136412MDP0000493703MDP0000843352MDP0000527985
MDP0000139136
Manihot esculentacassava4.1_011950mcassava4.1_032385mcassava4.1_024068mcassava4.1_011945mcassava4.1_029449m
Medicago truncatulaMedtr4g114450.1Medtr4g114210.1Medtr2g008710.1Medtr2g008730.1Medtr2g008160.1
Medtr2g008710.2Medtr2g008160.2
Mimulus guttatusmgv1a009839mmgv1a023088mmgv1a019228mmgv1a018852m
Oryza sativaLOC_Os01g07770.1LOC_Os11g10460.1LOC_Os12g08920.1
Panicum virgatumPavirv00006707mPavirv00035647mPavirv00001257mPavirv00018071mPavirv00058650m
Pavirv00013421m
Physcomitrella patensPp1s22_167V6.1Pp1s22_159V6.1
Phaseolus vulgarisPhvul.006G207100.1Phvul.009G197100.1Phvul.003G164600.1Phvul.006G209100.1
Picea abiesMA_93867g0010MA_10426026g0010MA_10429595g0010MA_10434825g0010MA_9805677g0010
Populus trichocarpaPotri.006G069600.1Potri.018G131600.1Potri.016G125000.1
Prunus persicappa008723mppa008667m
Ricinus communis28320.m00113629989.m00043230174.m00915527985.m000888
Setaria italicaSi002216mSi026601mSi010572m
Selaginella moellendorffii10494613291523327112210075799
8986123609714593212686397402
13675973829123452
Sorghum bicolorSb03g004380.1Sb08g005520.1Sb05g009400.1
Thellungiella halophilaThhalv10016924mThhalv10004567mThhalv10004581mThhalv10004557mThhalv10019514m
Thhalv10025604m
Vitis viniferaGSVIVT01015537001GSVIVT01015533001.522.787GSVIVT01015533001.522.787GSVIVT01015533001.49.309GSVIVT01015533001.49.309
GSVIVT01029748001GSVIVT01029771001GSVIVT01029776001GSVIVT01029774001GSVIVT01029775001
GSVIVT01029773001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)