y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G032500.1
FamilyCBM57
Protein PropertiesLength: 1174 Molecular Weight: 131020 Isoelectric Point: 7.547
ChromosomeChromosome/Scaffold: 02 Start: 2427626 End: 2433929
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM571843254.2e-24
  SINAGCLNGAVELDGVIYSNDDCFVGGDVIIADRIVGDGGGNSLYNTARLGDFSYNFLTLECGFYAIDLHFAEIVFTTGPPGIRVFDVFVQEEKVVTSLD
  IYGQVGANKPLVISNIRTFVDSGGGLLIRFEGLMGSPIVCGI
Full Sequence
Protein Sequence     Length: 1174     Download
MEDSNNFHHL RTDPLLLTDV SWQQNTSFYT DAAMASHSEN PSLSDLVSSP KQDSADVVDP    60
RQSQSPNVIS TPIREFDGRS MLGFSLTSPD LVICAGSPDI PSKAYGDSPE FLEKHRCSIE    120
VSLENGIEGS DNSKAKQKSP TVKFSTVCET FHKELSPESS FELLPLRETA DYSQHKHEDY    180
PAISINAGCL NGAVELDGVI YSNDDCFVGG DVIIADRIVG DGGGNSLYNT ARLGDFSYNF    240
LTLECGFYAI DLHFAEIVFT TGPPGIRVFD VFVQEEKVVT SLDIYGQVGA NKPLVISNIR    300
TFVDSGGGLL IRFEGLMGSP IVCGITVRKD SLESFKEAGS EEIMGMDKVG GHESPRDISD    360
CEIEVKYQIL QMDYERQKKE LAEMRSALEG LKRENKLKTK ECQEACKSLQ ELQNELMRKS    420
MHVGSLAFAI EGQVKEKSRW FSSLRDMTRK LKIMKMERIK LSEEVSHYKN CIMDINDFGT    480
KIQSRINQQA DLHEDLKTKY LKGAKERKEL YNKVLELKGN IRVFCRCRPL NSEEIAAGAS    540
LAIDFESAKD GELTVISNGA PKKTFRFDAV FGPHAEQADV FQDTAPFATS VLDGYNVCIF    600
AYGQTGTGKT FTMEGTKEAR GVNFRTLEEL FRVINERQKL YRYEISVSAL EVYNEQIRDL    660
LVSGSQQSTM AKRLEIRQVG EGMHHVPGLV EAHVNNMNEV WEVLQTGSNA RAVGSTNANE    720
HSSRSHCIHC VMVKGENLLN GECTKSKLWL VDLAGSERVA KTDVLGERLK ETQNINRSLS    780
ALGDVISALA TKSSHIPFRN SKLTHLLQDS LGGDSKALMF VQISPNENDL GETLCSLNFA    840
SRVRGIELGP AKKQMDTSEL LRWKQMVEKS KQDMKIKDLQ IRKMEETIHG LDLKMKDKDL    900
KNKNLQEKVK ELESQLLIER KLARQHVDTR IAEQQQKQQN EDVRPPLATR LLGTNKSSNE    960
VKNGTLMKEQ VNLTRPLTEN SFRPSMPLSV TDGSFKHIDP VEKENNPEVA EQLRLPTRTG    1020
RASMCPTIRR MPASSAPRRN SLIPLPSTPS SAQLAPPFHP LPSQPDIIEE VDEFIPEQTV    1080
CNSPKGTKSG GKKLSSILRR SLQKKVQLKS PMQQHLRRGL NVGMERVRVS IGSRGRMASR    1140
VLVGNGRKGG KEIQQKQNQK EKERAWNIGR TAI*                                1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01371KISc_KIF31.0e-97520846339+
cd00106KISc4.0e-121520844333+
pfam00225Kinesin2.0e-139526846330+
smart00129KISc1.0e-140520852340+
cd01366KISc_C_terminal1.0e-177518849333+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_177370.1013115761191kinesin motor protein-related [Arabidopsis thaliana]
RefSeqXP_002300478.1076115731083predicted protein [Populus trichocarpa]
RefSeqXP_002317602.10761172261125predicted protein [Populus trichocarpa]
RefSeqXP_002532828.107633145300ATP binding protein, putative [Ricinus communis]
RefSeqXP_002532828.1040211733621147ATP binding protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A05188483330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A05078721360A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C05168722352A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A05168722352A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B05168722352A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV9908452995778750
ES8650562885868730
DW0670342684937600
GW3377022957079960
FG1361502316538830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybridmrna26561.1-v1.0-hybrid
Glycine maxGlyma01g02620.1Glyma09g33340.2
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny