y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G032500.2
FamilyCBM57
Protein PropertiesLength: 1136 Molecular Weight: 126598 Isoelectric Point: 7.8543
ChromosomeChromosome/Scaffold: 02 Start: 2427826 End: 2433886
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM571512924e-24
  SINAGCLNGAVELDGVIYSNDDCFVGGDVIIADRIVGDGGGNSLYNTARLGDFSYNFLTLECGFYAIDLHFAEIVFTTGPPGIRVFDVFVQEEKVVTSLD
  IYGQVGANKPLVISNIRTFVDSGGGLLIRFEGLMGSPIVCGI
Full Sequence
Protein Sequence     Length: 1136     Download
MASHSENPSL SDLVSSPKQD SADVVDPRQS QSPNVISTPI REFDGRSMLG FSLTSPDLVI    60
CAGSPDIPSK AYGDSPEFLE KHRCSIEVSL ENGIEGSDNS KAKQKSPTVK FSTVCETFHK    120
ELSPESSFEL LPLRETADYS QHKHEDYPAI SINAGCLNGA VELDGVIYSN DDCFVGGDVI    180
IADRIVGDGG GNSLYNTARL GDFSYNFLTL ECGFYAIDLH FAEIVFTTGP PGIRVFDVFV    240
QEEKVVTSLD IYGQVGANKP LVISNIRTFV DSGGGLLIRF EGLMGSPIVC GITVRKDSLE    300
SFKEAGSEEI MGMDKVGGHE SPRDISDCEI EVKYQILQMD YERQKKELAE MRSALEGLKR    360
ENKLKTKECQ EACKSLQELQ NELMRKSMHV GSLAFAIEGQ VKEKSRWFSS LRDMTRKLKI    420
MKMERIKLSE EVSHYKNCIM DINDFGTKIQ SRINQQADLH EDLKTKYLKG AKERKELYNK    480
VLELKGNIRV FCRCRPLNSE EIAAGASLAI DFESAKDGEL TVISNGAPKK TFRFDAVFGP    540
HAEQADVFQD TAPFATSVLD GYNVCIFAYG QTGTGKTFTM EGTKEARGVN FRTLEELFRV    600
INERQKLYRY EISVSALEVY NEQIRDLLVS GSQQSTMAKR LEIRQVGEGM HHVPGLVEAH    660
VNNMNEVWEV LQTGSNARAV GSTNANEHSS RSHCIHCVMV KGENLLNGEC TKSKLWLVDL    720
AGSERVAKTD VLGERLKETQ NINRSLSALG DVISALATKS SHIPFRNSKL THLLQDSLGG    780
DSKALMFVQI SPNENDLGET LCSLNFASRV RGIELGPAKK QMDTSELLRW KQMQDMKIKD    840
LQIRKMEETI HGLDLKMKDK DLKNKNLQEK VKELESQLLI ERKLARQHVD TRIAEQQQKQ    900
QNEDVRPPLA TRLLGTNKSS NEVKNGTLMK EQVNLTRPLT ENSFRPSMPL SVTDGSFKHI    960
DPVEKENNPE VAEQLRLPTR TGRASMCPTI RRMPASSAPR RNSLIPLPST PSSAQLAPPF    1020
HPLPSQPDII EEVDEFIPEQ TVCNSPKGTK SGGKKLSSIL RRSLQKKVQL KSPMQQHLRR    1080
GLNVGMERVR VSIGSRGRMA SRVLVGNGRK GGKEIQQKQN QKEKERAWNI GRTAI*        1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01371KISc_KIF37.0e-98487813339+
cd00106KISc2.0e-121487811333+
pfam00225Kinesin1.0e-139493813330+
smart00129KISc5.0e-141487819340+
cd01366KISc_C_terminal4.0e-178485816333+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_177370.1011119361191kinesin motor protein-related [Arabidopsis thaliana]
RefSeqXP_002300478.1043111931083predicted protein [Populus trichocarpa]
RefSeqXP_002317602.10431134261125predicted protein [Populus trichocarpa]
RefSeqXP_002532828.104329845300ATP binding protein, putative [Ricinus communis]
RefSeqXP_002532828.1036911353621147ATP binding protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A04858153330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A04748331354A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C04838332346A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A04838332346A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B04838332346A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV9908452895448320
ES8650562815538330
DW0670342684607270
DT5751102885448310
GW3377022956749580
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybridmrna26561.1-v1.0-hybrid
Glycine maxGlyma01g02620.1Glyma09g33340.2
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny