y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G054000.1
FamilyGT4
Protein PropertiesLength: 415 Molecular Weight: 46427.6 Isoelectric Point: 8.0864
ChromosomeChromosome/Scaffold: 02 Start: 4778453 End: 4781381
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42183815.20022e-42
  FLSINRFERKKNIELAVSAFAMLRTLDGNVDRGSNFADADLTIAGGFDKRLRENVEYLDELKSLAERNGVAGQVNFVTSCSTAERNSLLSECLCVLYTPT
  DEHFGIVPLEAMAAHKPVIACNSGGPVETIKNGETGFLCDPSPKDFALAMAKFIQDPEMAKRMG
Full Sequence
Protein Sequence     Length: 415     Download
MERKKPTDSN SNSKLNIAII HPDLGIGGAE RLIVDAAVEL ASHGHNVHIF TAHHDKNRCF    60
EETRAGIFPV TVYGDFLPRH IFYRLHAVCA YLRCIFVALC VLFMWPSFDV ILADQVSVVV    120
PLLKLKRSTK VVFYCHFPDL LLAQHTTLLR RIYRKPIDII EELTTGMADM ILVNSRFTAS    180
TFAKTFKHLH ARGIRPAVLH PAVNVNQFDK PCSFKLNFLS INRFERKKNI ELAVSAFAML    240
RTLDGNVDRG SNFADADLTI AGGFDKRLRE NVEYLDELKS LAERNGVAGQ VNFVTSCSTA    300
ERNSLLSECL CVLYTPTDEH FGIVPLEAMA AHKPVIACNS GGPVETIKNG ETGFLCDPSP    360
KDFALAMAKF IQDPEMAKRM GEQARQHVNE SFSTTTFGQR LNQFLLDVAR TKWD*         420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03811GT1_WabH_like2.0e-3916393395+
COG0438RfaG1.0e-4014412405+
cd03798GT1_wlbH_like9.0e-4215408420+
cd03801GT1_YqgM_like7.0e-5216405409+
cd03805GT1_ALG2_like015401400+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU21459.10114145407unknown [Glycine max]
RefSeqNP_178001.20134117399glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002285480.1084142408PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317454.10144144413predicted protein [Populus trichocarpa]
RefSeqXP_002525620.1084142408alpha-1,3-mannosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A3e-1721837926168A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB2r68_A0.000000000002159412182463A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB2r66_A0.000000000002159412182463A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB2r60_A0.000000000002159412182463A Chain A, Structure Of Apo Sucrose Phosphate Synthase (Sps) Of Halothermothrix Orenii
PDB2jjm_L0.00000000002218410214387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
89108
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK274325312123230
EL44718731583220
GO87472534473470
EL45605232713270
EG522343301863860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00182.1Aquca_021_00182.2Aquca_021_00182.3
Arabidopsis lyrata477043
Arabidopsis thalianaAT1G78800.1
Brachypodium distachyonBradi5g19840.1
Brassica rapaBra035064
Carica papayaevm.model.supercontig_77.17
Capsella rubellaCarubv10022022m
Chlamydomonas reinhardtiig1920.t1
Citrus clementinaCiclev10022599mCiclev10020399m
Citrus sinensisorange1.1g036860m
Cucumis sativusCucsa.220170.2Cucsa.273740.2Cucsa.273740.1Cucsa.220170.1
Eucalyptus grandisEucgr.F01245.1
Fragaria vescamrna27271.1-v1.0-hybrid
Glycine maxGlyma12g35950.2Glyma12g35950.1Glyma13g34430.1Glyma13g34430.2
Gossypium raimondiiGorai.002G054000.2
Linum usitatissimumLus10037008Lus10015797
Malus domesticaMDP0000319369MDP0000185482
Manihot esculentacassava4.1_008785m
Medicago truncatulaMedtr1g104880.1
Mimulus guttatusmgv1a007424m
Oryza sativaLOC_Os04g49960.1
Panicum virgatumPavirv00018845mPavirv00056995mPavirv00050038mPavirv00004378m
Physcomitrella patensPp1s246_77V6.1
Phaseolus vulgarisPhvul.005G081600.1
Picea abiesMA_499839g0010
Populus trichocarpaPotri.011G109000.1
Prunus persicappa006490mppa006502m
Ricinus communis29681.m001322
Setaria italicaSi017356mSi013830mSi010219m
Selaginella moellendorffii419620
Sorghum bicolorSb06g026860.1
Thellungiella halophilaThhalv10019736mThhalv10007837m
Vitis viniferaGSVIVT01014186001
Volvox carteriVocar20014584m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny