y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G065500.1
FamilyGT1
Protein PropertiesLength: 473 Molecular Weight: 52995.1 Isoelectric Point: 5.8431
ChromosomeChromosome/Scaffold: 02 Start: 7674365 End: 7675959
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12264187.7e-22
  DYVARGFGKPVLLSGPCLPETKTQQLDEKWVSWLSQFEPGSVVFCSLGSQSVLQKDEFQELLLGFELCGLPFLLALKPPQGCSTVEEALPEGFQDRVGGR
  GLVYGGWVPQEQLLHHPNIGCFVNHCGYGTMWEFLLSDCQVVLIPEIGDQILNTRLMANELKIGVEVERGKNREVPKESLSEAIKFVMDKDNE
Full Sequence
Protein Sequence     Length: 473     Download
MGKSGYSKLH IAMFPWVAYG HFIPFLHLSN KLAHKGHQIS FILPKGVQPK LENMNQYPNL    60
IQFVPLVIPH VDGLPPGAET TSVVPLNQQK YLAFSVDQTR DQVEGILGAL KPDMVFYDFW    120
FWIPDLARQL GIQPIFYVVV SSMIMSLGSN IRTLTKEMTV EEVTKLPPDY PSSTVKFKAE    180
EAAALLFEAE DFGSGLSFGE RIRTAVSGSD AIAFRTCRET EGPFCDYVAR GFGKPVLLSG    240
PCLPETKTQQ LDEKWVSWLS QFEPGSVVFC SLGSQSVLQK DEFQELLLGF ELCGLPFLLA    300
LKPPQGCSTV EEALPEGFQD RVGGRGLVYG GWVPQEQLLH HPNIGCFVNH CGYGTMWEFL    360
LSDCQVVLIP EIGDQILNTR LMANELKIGV EVERGKNREV PKESLSEAIK FVMDKDNETA    420
NMMKRNHAKL KQMLSNRDLQ EGYINNFIQA LQDLSNRKSK LQNKMNKPDD VW*           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03007PLN030073.0e-397458489+
PLN02670PLN026707.0e-777462476+
PLN00414PLN004145.0e-1557458455+
PLN02208PLN022083.0e-1668453450+
PLN02764PLN027644.0e-1695459460+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_194486.1054602455glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002282717.1014581459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282825.10845410459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316802.1044586463predicted protein [Populus trichocarpa]
RefSeqXP_002523261.1014561459UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hbj_A2e-20256432264429B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3hbf_A2e-20256432264429A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2pq6_A5e-20252432282454A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A1e-19104148428A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8133493261414610
ES8195902412334730
ES8272052362334680
DW5100912032524540
CO4914271962784730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)