y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G066600.1
FamilyGT1
Protein PropertiesLength: 459 Molecular Weight: 51307.6 Isoelectric Point: 5.3405
ChromosomeChromosome/Scaffold: 02 Start: 7766223 End: 7767725
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12274203.9e-23
  LCDYISSQYQKQVLLTGPVLPEDSKSSLDERWSNWLAGFEPGSVVFCAFGSQLILEMAQFRELVLAFELTGLPFFIALKPPLGAEKVEEALPEGFEERVK
  GRGVVYGAWVQQPLVLAHPSVGCFVSHCGFGSMWESLLSDCQIVLVPHLGDQILNTRLLADEMKVAVEVKKEENGWISKENLSEAIKSVMDKES
Full Sequence
Protein Sequence     Length: 459     Download
MAETDSSEFR MLMFPWFAFG HMTPYLHLAN KLAQKGYRIT FATPQKAINR LRHLNLFPDF    60
ISFHVITVPS VTGLPPGAET ASDVPIFLTH FLAIALDLTR DQLESLVTSI KPKFIIYDAA    120
YWIPEVAKPL GIKTINFNVV SAASIAIVLV PARNVPKDRP ITMEELATPP PGYPSTSVVL    180
RGTELETLLF VTNPFGEEMT FYERITLSMK NCDVISIRTC YEVEGKLCDY ISSQYQKQVL    240
LTGPVLPEDS KSSLDERWSN WLAGFEPGSV VFCAFGSQLI LEMAQFRELV LAFELTGLPF    300
FIALKPPLGA EKVEEALPEG FEERVKGRGV VYGAWVQQPL VLAHPSVGCF VSHCGFGSMW    360
ESLLSDCQIV LVPHLGDQIL NTRLLADEMK VAVEVKKEEN GWISKENLSE AIKSVMDKES    420
EVGKLVMENH KKWREVINPN LMNGYIDKFL QGMRQPVS*                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028632.0e-381389419+
PLN02670PLN026705.0e-655416428+
PLN02208PLN0220808455450+
PLN02764PLN0276408458455+
PLN00414PLN0041407457455+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63557.1014531443hypothetical protein [Vitis vinifera]
RefSeqNP_200212.1064572447glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002282825.1014533459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316802.1044586461predicted protein [Populus trichocarpa]
RefSeqXP_002523261.1014581459UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A3e-24195438193430A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2c1z_A3e-24195438193430A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2c1x_A3e-24195438193430A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vg8_A4e-22206436201445A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vch_A4e-22206436201445A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY26848533093380
DY28760037993830
DY28158531543180
DY28648835793630
FC90108630293100
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1Gorai.010G242800.1
Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)