y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G092000.1
FamilyGT61
Protein PropertiesLength: 455 Molecular Weight: 51835.5 Isoelectric Point: 6.5116
ChromosomeChromosome/Scaffold: 02 Start: 11658129 End: 11660050
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT61823130
  DVHTQVCVANKPVRIYYKGLTVYVPSDSDQPQVKRIVKPYARLEDETAMKRVSPVQILHGKNTIDPPACNFTHNVTAVVFSSKGFTGNVFHEFNEIIIPL
  FITTRHFRSRVRFVITDFELWWVQKYNRCLSHLSAYEVINPGTDDGSVHCFPGAVIGLTYHDNLALNSTDIPGGYSMFDFKQFLKESYNLKINHVSEIQK
  PMLMLISRRKTRRFLNEDKMVEMIMELGFQIT
Full Sequence
Protein Sequence     Length: 455     Download
MMEKESGRLV NCATLPICLV LISLVYATFF HSNDTILESW GNLSSEKINI DAVDPQEFLL    60
RRLVRGDDRV QLDSNGFSCR ADVHTQVCVA NKPVRIYYKG LTVYVPSDSD QPQVKRIVKP    120
YARLEDETAM KRVSPVQILH GKNTIDPPAC NFTHNVTAVV FSSKGFTGNV FHEFNEIIIP    180
LFITTRHFRS RVRFVITDFE LWWVQKYNRC LSHLSAYEVI NPGTDDGSVH CFPGAVIGLT    240
YHDNLALNST DIPGGYSMFD FKQFLKESYN LKINHVSEIQ KPMLMLISRR KTRRFLNEDK    300
MVEMIMELGF QITRVEPEWM YNLDEFAEVV NSCSVMLGAH GAGLTNEIFL PTGAVMVQVV    360
PLQNEWVATT YYGGPAKEMG VRYLEYKIEP EESSLFDTYG KDHPVFTDPK SIISKGYNAF    420
RSVYLDQDLK INLERFKKTL IEAKQIVESS TPIN*                               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44211.0e-6287393110+
pfam04577DUF5638.0e-12168383222+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG48121.10118443336662glycosyltransferase [Zea mays]
GenBankACN27042.10118443335662unknown [Zea mays]
EMBLCBI26676.14e-201513141156unnamed protein product [Vitis vinifera]
EMBLCBI26676.10194451158417unnamed protein product [Vitis vinifera]
RefSeqNP_001130385.10118443336663hypothetical protein LOC100191481 [Zea mays]
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY1969062361433780
EX1647452361433780
FC8973322332264550
EY196906243763990.51
EX164745243763990.51
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00340.1Aquca_002_00751.1Aquca_035_00185.1
Arabidopsis lyrata483244486181478362322639341951
479312
Arabidopsis thalianaAT2G41640.2AT2G41640.1AT3G57380.1AT3G10320.1AT2G03360.2
AT2G03360.1AT2G03370.1AT3G18180.1AT3G18170.1
Brachypodium distachyonBradi1g19160.1Bradi2g26590.1Bradi2g13600.1Bradi2g25450.1Bradi3g11310.1
Bradi2g61230.1Bradi1g34647.1Bradi2g01480.1Bradi1g06560.1Bradi3g03120.1
Bradi3g11337.1Bradi1g34670.1Bradi2g01420.1Bradi4g27360.1Bradi2g01497.1
Bradi2g01380.1Bradi3g11300.1Bradi2g01387.1Bradi4g43180.1Bradi3g09797.1
Bradi4g27930.1
Brassica rapaBra004633Bra007323Bra029830Bra024778Bra017388
Bra022291Bra021298Bra022290
Carica papayaevm.model.supercontig_329.1evm.model.supercontig_3.447evm.model.supercontig_3.448
Capsella rubellaCarubv10023085mCarubv10017113mCarubv10015940mCarubv10018757mCarubv10013301m
Citrus clementinaCiclev10004678mCiclev10005067mCiclev10033490mCiclev10033317mCiclev10010569m
Ciclev10010793mCiclev10010510mCiclev10010148m
Citrus sinensisorange1.1g013451morange1.1g008963morange1.1g008862morange1.1g043548morange1.1g044947m
orange1.1g037469morange1.1g040560morange1.1g041159morange1.1g036415m
Cucumis sativusCucsa.268990.1Cucsa.023950.1
Eucalyptus grandisEucgr.A02332.1Eucgr.A02333.1Eucgr.G02466.1Eucgr.K02245.1Eucgr.B00844.1
Eucgr.H04827.1Eucgr.F03489.1Eucgr.B03184.1Eucgr.F02597.1Eucgr.L00065.1
Eucgr.H03823.1Eucgr.D00867.1Eucgr.L03246.1Eucgr.F03488.1Eucgr.K01068.1
Fragaria vescamrna02487.1-v1.0-hybridmrna02435.1-v1.0-hybridmrna03424.1-v1.0-hybridmrna15618.1-v1.0-hybridmrna09431.1-v1.0-hybrid
Glycine maxGlyma03g29090.1Glyma19g31900.2Glyma02g12620.2Glyma05g34170.2Glyma05g34170.1
Glyma08g05490.1
Gossypium raimondiiGorai.006G136200.1Gorai.003G090500.1Gorai.013G090800.2Gorai.013G090800.1Gorai.006G057800.1
Gorai.006G057500.1Gorai.008G287900.1Gorai.006G057600.1Gorai.006G057500.3Gorai.006G057500.2
Gorai.006G057700.1Gorai.002G092000.4Gorai.002G092000.3Gorai.002G092000.2Gorai.002G092000.5
Gorai.005G143500.1
Linum usitatissimumLus10018046Lus10018048Lus10042043Lus10035441Lus10031057
Lus10042044Lus10036806Lus10016707Lus10036003Lus10037123
Lus10032459Lus10032460Lus10042956Lus10042954Lus10032457
Lus10032454
Malus domesticaMDP0000121166MDP0000321558MDP0000221867MDP0000227955MDP0000707429.589.836
MDP0000707429.589.836MDP0000235299.445.689MDP0000235299.445.689MDP0000560181MDP0000707429.162.407
MDP0000707429.162.407MDP0000223022MDP0000148314MDP0000304008MDP0000240474
MDP0000235299.39.212MDP0000235299.39.212MDP0000520482
Manihot esculentacassava4.1_005722mcassava4.1_031341mcassava4.1_031847mcassava4.1_032696m
Medicago truncatulaMedtr7g091280.1Medtr8g106640.4Medtr8g106640.3Medtr8g106640.2Medtr8g106640.1
Medtr5g043220.1Medtr5g043230.1Medtr5g011170.1Medtr8g106650.1
Mimulus guttatusmgv1a004553mmgv1a022061mmgv1a020257mmgv1a026973mmgv1a018003m
mgv1a005861mmgv1a025512mmgv1a004323mmgv1a023149mmgv1a025882m
mgv1a005503m
Oryza sativaLOC_Os01g31370.1LOC_Os07g46380.1LOC_Os05g32544.2LOC_Os05g32544.1LOC_Os01g72610.1
LOC_Os03g37010.3LOC_Os03g37010.2LOC_Os03g37010.1LOC_Os02g22480.2LOC_Os02g22480.1
LOC_Os06g49300.1LOC_Os01g02900.2LOC_Os01g02900.1LOC_Os01g02910.1LOC_Os02g04250.1
LOC_Os02g04250.3LOC_Os02g22190.1LOC_Os02g22380.1LOC_Os06g49320.1LOC_Os12g13640.1
LOC_Os01g02920.1LOC_Os02g22650.2LOC_Os02g22650.1LOC_Os01g02940.6LOC_Os01g02940.4
LOC_Os01g02940.3LOC_Os01g02940.2LOC_Os01g02940.1LOC_Os06g27560.1LOC_Os06g28124.1
LOC_Os01g02930.1LOC_Os06g20570.1LOC_Os11g36700.1LOC_Os04g12010.2LOC_Os04g12010.1
LOC_Os10g35020.2LOC_Os10g35020.1LOC_Os06g13710.1
Panicum virgatumPavirv00056176mPavirv00043258mPavirv00046901mPavirv00031748mPavirv00040250m
Pavirv00061170mPavirv00006228mPavirv00009368mPavirv00054787mPavirv00009978m
Pavirv00034093mPavirv00041559mPavirv00015246mPavirv00022131mPavirv00064670m
Pavirv00048619mPavirv00015290mPavirv00058245mPavirv00020732mPavirv00006398m
Pavirv00061331mPavirv00001879mPavirv00047426mPavirv00051246mPavirv00020462m
Pavirv00059483mPavirv00070034mPavirv00031146mPavirv00010892mPavirv00033564m
Pavirv00003077mPavirv00038072mPavirv00059589mPavirv00064215mPavirv00031770m
Pavirv00032228mPavirv00027471mPavirv00058981mPavirv00004063mPavirv00050214m
Pavirv00042362mPavirv00045981mPavirv00000278mPavirv00056306mPavirv00024723m
Pavirv00068165mPavirv00006302mPavirv00026325mPavirv00064715mPavirv00035493m
Pavirv00007252mPavirv00006303mPavirv00018705mPavirv00015924mPavirv00035580m
Pavirv00033385mPavirv00037929mPavirv00064046mPavirv00012730mPavirv00024750m
Pavirv00064714mPavirv00035369mPavirv00027158mPavirv00064859mPavirv00066111m.82.191
Pavirv00066111m.82.191Pavirv00056675mPavirv00036383mPavirv00027771m.122.221Pavirv00027771m.122.221
Physcomitrella patensPp1s330_20V6.1Pp1s41_129V6.1
Phaseolus vulgarisPhvul.001G130200.1Phvul.002G326500.1
Picea abiesMA_119799g0010MA_174482g0010MA_488017g0010MA_10427112g0010MA_741838g0010
MA_461489g0010MA_10434370g0040MA_10434370g0050
Populus trichocarpaPotri.006G048500.1Potri.016G057000.2Potri.016G057000.1Potri.006G048500.2Potri.016G057000.3
Potri.010G162200.1Potri.008G092700.1Potri.010G162100.1Potri.012G051500.4Potri.012G051500.3
Potri.012G051500.2Potri.012G051500.1Potri.015G042300.2Potri.015G042300.1Potri.015G042200.1
Potri.012G051700.1
Prunus persicappa019715mppa004655mppa020741mppa008015mppa025612m
ppa024087m
Ricinus communis29775.m00010030174.m00915430174.m00915330153.m000746
Setaria italicaSi000933mSi033309mSi024459mSi001094mSi006142m
Si006141mSi004375mSi017128mSi016722mSi000850m
Si008765mSi004816mSi000628mSi000691mSi000604m
Si039845mSi016956mSi016747mSi008795mSi021870m
Si000871mSi017259mSi017061mSi008074mSi006260m
Si000544mSi001137mSi003993mSi001572mSi000966m
Si006228mSi016967mSi006527mSi001525mSi006326m
Si016895mSi004430mSi008063mSi008125m
Selaginella moellendorffii119028573642657486384
Sorghum bicolorSb02g041650.1Sb09g019360.1Sb10g018300.1Sb03g046290.1Sb04g013150.1
Sb03g009110.1Sb10g020480.1Sb10g020470.1Sb03g008020.1Sb01g025290.1
Sb03g008000.1Sb10g029360.1Sb03g007910.1Sb03g007960.1Sb04g002850.1
Sb04g000840.1Sb10g020460.1Sb04g020210.1Sb10g018270.1Sb03g007900.1
Sb10g029380.1Sb03g007920.1Sb10g002800.1Sb03g007950.1Sb03g007370.1
Sb03g008010.1Sb03g042820.2Sb03g042820.1Sb04g035100.1
Thellungiella halophilaThhalv10016562mThhalv10005928mThhalv10020581mThhalv10005346mThhalv10007530m
Thhalv10020483mThhalv10008470m
Vitis viniferaGSVIVT01033248001GSVIVT01010089001GSVIVT01008368001GSVIVT01037699001
Zea maysAC216871.3_FGT001AC216871.3_FGT004
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)