y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G132300.1
FamilyGH13
Protein PropertiesLength: 416 Molecular Weight: 46334.1 Isoelectric Point: 4.7013
ChromosomeChromosome/Scaffold: 02 Start: 20736799 End: 20738651
Descriptionalpha-amylase-like
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13323342.79979e-42
  SSNKAGGWYNFLQSSVSDISNAGVTHVWLPPPSQSAAPQGYLPGRLYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGG
  TSDDRLDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDGWRFDFVRGYAPTITKIYMDRTSPDFAVGEKWEDFI
  DGQEDLHRAALKDWVEAAGGAVTAFDFTTKGVLNDAVQGKLWRLKDSSGKPPGMIGLLPQNAVTFIDNHDTGSTQNIWPFPSDKIMQGYAYILTHPGIPS
  IFY
Full Sequence
Protein Sequence     Length: 416     Download
MLTSLCFVFI FIFVFSPFAT PTLLFQGFNW ESSNKAGGWY NFLQSSVSDI SNAGVTHVWL    60
PPPSQSAAPQ GYLPGRLYDL DASKYGSQAE LKSLIDAFHQ KGVKCVADIV INHRTAERQD    120
NRGIYCLFEG GTSDDRLDWG PSFICKDDTA YSDGTGNPDT GLPYDPAPDI DHLNPRVQNE    180
LSDWLNWLKT EIGFDGWRFD FVRGYAPTIT KIYMDRTSPD FAVGEKWEDF IDGQEDLHRA    240
ALKDWVEAAG GAVTAFDFTT KGVLNDAVQG KLWRLKDSSG KPPGMIGLLP QNAVTFIDNH    300
DTGSTQNIWP FPSDKIMQGY AYILTHPGIP SIFYDHFFDL GLKDEISKLV EIRNRNGIQS    360
TSTVTIRASE SELYMASIDD KIIMKIGPKM DLGNLVPPNY QLATSGNNYA VWEKK*        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09441PRK094412.0e-5124355400+
PLN02784PLN027843.0e-13623415404+
PLN02361PLN023613.0e-14323414404+
cd11314AmyAc_arch_bac_plant_AmyA8.0e-16124364344+
PLN00196PLN0019604414421+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004556alpha-amylase activity
GO:0005509calcium ion binding
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PRF/SEQDB024134421UP10_LACSN Unknown protein 10 from 2D-PAGE
DDBJBAC76729.1024134421alpha-amylase [Vigna angularis]
Swiss-ProtP17859024134421AMYA_VIGMU RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan glucanohydrolase; Flags: Precursor
RefSeqXP_002301187.10224154404predicted protein [Populus trichocarpa]
RefSeqXP_002327139.1044145423predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bg9_A0234142402A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB1ava_B0234142402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB1ava_A0234142402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB1amy_A0234142402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB2qpu_C0234143404A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN950032236182460
DN9500321702474160
HO476908401224140
HO420508402224160
HO409542403224150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00499.1.534.822Aquca_002_00499.2.534.792Aquca_043_00069.1Aquca_015_00065.1Aquca_015_00064.1
Aquca_015_00064.2
Arabidopsis lyrata339218.513.801316534492338
Arabidopsis thalianaAT1G69830.1.517.806AT1G76130.1AT4G25000.1
Brachypodium distachyonBradi2g48150.1.502.788Bradi5g08800.3Bradi5g08800.1Bradi1g35050.1Bradi5g08800.2
Bradi4g32140.1Bradi3g58010.1
Brassica rapaBra016262.525.815Bra015784Bra036881
Carica papayaevm.model.supercontig_5.271.357.671evm.model.supercontig_26.242evm.model.supercontig_14.168evm.model.supercontig_49.22evm.model.supercontig_49.17
Capsella rubellaCarubv10019759m.532.819Carubv10020375mCarubv10004897m
Chlamydomonas reinhardtiiCre08.g362450.t1.2Cre08.g385500.t2.1Cre08.g385500.t1.2Cre08.g384750.t1.1
Citrus clementinaCiclev10018086mCiclev10030780m.385.674Ciclev10030661m.533.822Ciclev10001348mCiclev10001266m
Citrus sinensisorange1.1g045962morange1.1g006158m.291.578orange1.1g003698m.435.722orange1.1g003004m.533.820orange1.1g002611m.533.820
orange1.1g002585m.533.820orange1.1g003613m.533.791orange1.1g015125morange1.1g014892morange1.1g004353m.533.733
orange1.1g014447morange1.1g018278morange1.1g021281morange1.1g018833m
Cucumis sativusCucsa.285330.2.390.679Cucsa.285330.1.530.819Cucsa.271900.2Cucsa.271900.1
Eucalyptus grandisEucgr.G02543.2.545.839Eucgr.G02543.1.545.840Eucgr.F03529.1Eucgr.F02347.2Eucgr.F02347.1
Eucgr.F02347.4Eucgr.F02347.3Eucgr.F02349.1
Fragaria vescamrna04286.1-v1.0-hybridmrna08602.1-v1.0-hybridmrna28570.1-v1.0-hybridmrna28571.1-v1.0-hybrid
Glycine maxGlyma08g26861.3Glyma08g26861.2Glyma08g26861.1Glyma08g26861.4Glyma02g02450.1.530.816
Glyma08g40810.1.553.842Glyma14g39930.1Glyma17g36090.1
Gossypium raimondiiGorai.007G082900.3Gorai.007G082900.2Gorai.007G082900.1Gorai.007G082900.4Gorai.008G182600.3.522.810
Gorai.008G182600.1.524.812Gorai.005G139200.3Gorai.005G139200.2Gorai.005G139200.1Gorai.008G182600.6.524.783
Gorai.007G082900.5Gorai.010G001000.2Gorai.010G001000.1Gorai.009G268400.1Gorai.008G182600.4.524.727
Gorai.008G182600.5.524.726Gorai.008G182600.2.524.726Gorai.009G211600.1Gorai.009G211600.2Gorai.009G268400.2
Linum usitatissimumLus10036717.524.811Lus10013270.535.823Lus10030793.532.820Lus10037211.523.823Lus10021836
Lus10042655Lus10021728
Malus domesticaMDP0000210170MDP0000261503MDP0000162817.633.919MDP0000167257MDP0000298815.275.582
MDP0000298815.275.582MDP0000298815.637.941MDP0000298815.637.941MDP0000417791MDP0000135529
Manihot esculentacassava4.1_028069mcassava4.1_001555m.526.816cassava4.1_001362m.526.816cassava4.1_025145mcassava4.1_008802m
cassava4.1_008754mcassava4.1_008351mcassava4.1_008126mcassava4.1_023754m
Medicago truncatulaMedtr1g019440.1Medtr7g013300.1Medtr1g026170.1Medtr1g019480.1
Mimulus guttatusmgv1a001047mmgv1a001104m.518.806mgv1a001785mmgv1a007250mmgv1a006910m
Oryza sativaLOC_Os01g51754.2LOC_Os01g51754.1LOC_Os04g33040.1LOC_Os06g49970.2LOC_Os08g36900.1
LOC_Os08g36910.2LOC_Os08g36910.1LOC_Os09g28420.1LOC_Os08g36900.2LOC_Os09g28400.1
LOC_Os02g52700.1LOC_Os08g36910.3LOC_Os02g52710.1
Panicum virgatumPavirv00030888m.502.788Pavirv00061832m.515.801Pavirv00065049mPavirv00023068mPavirv00055456m
Pavirv00012930mPavirv00053436mPavirv00035106mPavirv00011095mPavirv00029041m
Pavirv00048051mPavirv00009684mPavirv00049157mPavirv00043521mPavirv00039683m
Pavirv00050888mPavirv00007311mPavirv00048050mPavirv00022620mPavirv00060260m
Pavirv00027292m
Physcomitrella patensPp1s342_20V6.1Pp1s100_191V6.1Pp1s223_59V6.2Pp1s223_59V6.1Pp1s13_335V6.1
Pp1s526_11V6.2Pp1s526_11V6.1Pp1s7_147V6.3Pp1s7_147V6.2Pp1s7_147V6.1
Pp1s148_45V6.1
Phaseolus vulgarisPhvul.008G033800.1Phvul.002G065700.1.549.837Phvul.003G069200.1.555.843Phvul.001G001900.1Phvul.010G017600.1
Picea abiesMA_30833g0020MA_17799g0010MA_400732g0010MA_336273g0010
Populus trichocarpaPotri.002G126300.1Potri.017G093200.1Potri.010G092900.7Potri.010G092900.5.536.826Potri.010G092900.4.532.822
Potri.010G092900.3.547.837Potri.010G092900.2.543.833Potri.010G092900.1.547.837Potri.010G092900.6.547.806Potri.002G014300.6
Potri.002G014300.5Potri.002G014300.4Potri.002G014300.3Potri.002G014300.2Potri.002G014300.1
Potri.014G029400.1Potri.002G126300.2
Prunus persicappa000951mppa001575m.432.720ppa006402mppa006152mppa006160m
Ricinus communis29630.m00083329736.m002033.533.82130170.m01430930170.m01387730170.m013878
32625.m000028
Setaria italicaSi000308m.516.802Si000258m.516.802Si010227mSi010224mSi006474m
Si013788mSi013755mSi022119mSi013704mSi029876m
Si029874mSi029873mSi013789mSi022334mSi008671m
Si006461mSi017283mSi032583mSi027629m
Selaginella moellendorffii127605976253394079072404058
Sorghum bicolorSb04g034150.1Sb03g032830.1.455.740Sb06g015110.1Sb02g026620.1Sb02g026610.1
Sb07g023020.2Sb07g023020.1Sb07g023010.1Sb02g023790.1Sb04g034140.1
Sb02g023250.1
Thellungiella halophilaThhalv10018099m.531.819Thhalv10018632mThhalv10018631mThhalv10025232m
Vitis viniferaGSVIVT01031746001GSVIVT01032922001GSVIVT01020069001.513.804GSVIVT01008714001GSVIVT01031740001
Volvox carteriVocar20003157mVocar20004587m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)