y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G172000.3
FamilyCE11
Protein PropertiesLength: 296 Molecular Weight: 32574.4 Isoelectric Point: 6.9009
ChromosomeChromosome/Scaffold: 02 Start: 43609000 End: 43614342
DescriptionUDP-3-O-acyl N-acetylglycosamine deacetylase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE11252810
  QQTLAGCIELSGKTLHSGKVSKVKIWPVFAGEGRYFEFHSNLIPASIDFVRESLLCTTLCKDGYKIRTVEHLLSALEAKGIDNCRIQIQSLDSEDTEVEV
  PIFDGSANAWVEAIEQVGRKEALDRCGNNVEKLAPHLSEPFYVSRNDSFMVAFPASKVHISCGIDFPKVPAIGCQWFSSAALDDSYEKHIACSRTFCIYE
  EVEHMCSMGLIKGGSLDNAIVCSATKGWLNPPLRFPDEPCRHKVLDLIGDLSLFARS
Full Sequence
Protein Sequence     Length: 296     Download
MRLSAAINSF KSSNLISWKT TGKLQQTLAG CIELSGKTLH SGKVSKVKIW PVFAGEGRYF    60
EFHSNLIPAS IDFVRESLLC TTLCKDGYKI RTVEHLLSAL EAKGIDNCRI QIQSLDSEDT    120
EVEVPIFDGS ANAWVEAIEQ VGRKEALDRC GNNVEKLAPH LSEPFYVSRN DSFMVAFPAS    180
KVHISCGIDF PKVPAIGCQW FSSAALDDSY EKHIACSRTF CIYEEVEHMC SMGLIKGGSL    240
DNAIVCSATK GWLNPPLRFP DEPCRHKVLD LIGDLSLFAR SGSQGFPMAR VISFK*        300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13188PRK131887.0e-5925295304+
TIGR00325lpxC4.0e-6625295277+
COG0774LpxC7.0e-7824295281+
pfam03331LpxC1.0e-8225295277+
PRK13186lpxC4.0e-9325295279+
Gene Ontology
GO TermDescription
GO:0008759UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN61403.1012951333hypothetical protein [Vitis vinifera]
EMBLCBI26831.1012951296unnamed protein product [Vitis vinifera]
RefSeqNP_173874.2012951310UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqXP_002281269.1012951296PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002526001.1012951302UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xxe_A5e-32242793239A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB3p76_A4e-31242793239A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB2o3z_B4e-31242793239A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB2o3z_A4e-31242793239A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB2j65_B4e-31242793239A Chain A, Structure Of Lpxc From Aquifex Aeolicus In Complex With Udp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ40553121472200
BE05397120112010
CU58589422832300
CK277774275112840
GE60806027652790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00088.3Aquca_091_00088.2Aquca_091_00088.1
Arabidopsis lyrata472870
Arabidopsis thalianaAT1G25054.1AT1G24793.2AT1G25210.2AT1G24793.1AT1G24880.1
AT1G25054.2AT1G25145.1AT1G25210.1
Brachypodium distachyonBradi1g69490.1
Brassica rapaBra010979
Carica papayaevm.model.supercontig_2.193
Capsella rubellaCarubv10009664m
Chlamydomonas reinhardtiiCre16.g653350.t1.2
Citrus clementinaCiclev10015996mCiclev10015964m
Citrus sinensisorange1.1g042138m
Cucumis sativusCucsa.188640.1Cucsa.188650.1
Eucalyptus grandisEucgr.B02675.2Eucgr.B02675.1
Glycine maxGlyma02g09350.1
Gossypium raimondiiGorai.002G172000.4Gorai.002G172000.5Gorai.002G172000.1Gorai.002G172000.2Gorai.002G172000.6
Gorai.001G151600.1Gorai.010G050600.1Gorai.005G149500.1Gorai.005G145500.1Gorai.009G391300.3
Gorai.009G391300.2Gorai.009G391300.1Gorai.007G245600.1
Linum usitatissimumLus10003708Lus10001592
Malus domesticaMDP0000319902MDP0000264715MDP0000150490
Manihot esculentacassava4.1_012733m
Mimulus guttatusmgv1a025203m
Oryza sativaLOC_Os03g12320.3LOC_Os03g12320.2LOC_Os03g12320.1
Panicum virgatumPavirv00014435mPavirv00025226m
Physcomitrella patensPp1s1_376V6.1
Phaseolus vulgarisPhvul.003G019200.2Phvul.003G019200.1
Picea abiesMA_159099g0220MA_10433938g0010
Populus trichocarpaPotri.010G106400.1Potri.010G106400.2Potri.T177300.1Potri.010G106400.3
Prunus persicappa009014m
Ricinus communis29673.m000948
Setaria italicaSi036592mSi010565mSi036620m
Selaginella moellendorffii117127
Sorghum bicolorSb01g042410.1
Thellungiella halophilaThhalv10007963m
Vitis viniferaGSVIVT01011660001
Volvox carteriVocar20012425m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny