y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G175700.3
FamilyGH9
Protein PropertiesLength: 356 Molecular Weight: 39489 Isoelectric Point: 9.2799
ChromosomeChromosome/Scaffold: 02 Start: 44815627 End: 44819646
Descriptionglycosyl hydrolase 9B1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9343380
  DYHDALRKSILFFEGQRSGKLPPDQRVKWRRDSALRDGSTAGVDLTGGYYDAGDNVKFGFPMAFTTTLLAWSIIDFGRNMGPELKNAVKAVKWSTDYLLK
  ATAKPGVVYVQVGDAYSDHSCWERPEDMDTLRTVYKIDNAHPGSDVAGETAAALAAASIVFRSRDPAYSRLLLNRAVRVFNFADKHRGAYSSSLHAAVCP
  FYCDVNGYQDELLWAAAWLHKASRKRAYREYIVKNEVVLRAGDTINEFGWDNKHAGINVLISKEVLMGRADYFESFKQNADGFICSILPGITHPQVQYSP
  GKNAY
Full Sequence
Protein Sequence     Length: 356     Download
MAPKSFSFPG IFPALLASSL ALLLLPTPII AVHDYHDALR KSILFFEGQR SGKLPPDQRV    60
KWRRDSALRD GSTAGVDLTG GYYDAGDNVK FGFPMAFTTT LLAWSIIDFG RNMGPELKNA    120
VKAVKWSTDY LLKATAKPGV VYVQVGDAYS DHSCWERPED MDTLRTVYKI DNAHPGSDVA    180
GETAAALAAA SIVFRSRDPA YSRLLLNRAV RVFNFADKHR GAYSSSLHAA VCPFYCDVNG    240
YQDELLWAAA WLHKASRKRA YREYIVKNEV VLRAGDTINE FGWDNKHAGI NVLISKEVLM    300
GRADYFESFK QNADGFICSI LPGITHPQVQ YSPGKNAYFH LPFVKHRISG EKGQK*        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026133.0e-12834334303+
PLN03009PLN030099.0e-14426338316+
pfam00759Glyco_hydro_95.0e-14534338311+
PLN02266PLN022663.0e-16126334309+
PLN02308PLN0230801334334+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ15174.1013341335AF357587_1 endo-1,4-beta-glucanase isoform 01 [Fragaria x ananassa]
GenBankAAQ15178.1013341335AF357591_1 endo-1,4-beta-glucanase isoform 05 [Fragaria x ananassa]
EMBLCAA67157.1013341328endo-1,4-beta-glucanase [Arabidopsis thaliana]
RefSeqXP_002315868.103333417318predicted protein [Populus trichocarpa]
RefSeqXP_002527779.1013341331endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0322962266A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ksc_A0322962266A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ks8_A0322962266A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0343375308A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0343375308A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
1032
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT55356629112910
DN78059928312830
FC917888297343300
DY298091297343300
DT54560727912790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00141.2Aquca_037_00141.1.27.488Aquca_032_00063.1Aquca_002_01464.1.25.486Aquca_032_00063.2
Aquca_003_00343.1Aquca_037_00054.1Aquca_002_00269.1Aquca_020_00499.1Aquca_091_00045.1
Aquca_009_00142.1Aquca_037_00250.2Aquca_037_00053.1Aquca_037_00052.1Aquca_037_00250.1
Aquca_013_00114.1.225.506Aquca_013_00114.1.225.506Aquca_013_00683.1Aquca_017_00132.1Aquca_008_00102.1
Aquca_007_00351.1Aquca_013_00682.1Aquca_001_00802.1Aquca_091_00045.2Aquca_007_00351.2
Aquca_017_00132.2Aquca_037_00250.3
Arabidopsis lyrata489943.26.487892975.25.486856281482241474038.30.491
346267483586903880894888335563
327156492512912356484821352898
490341887421476269335523490669
Arabidopsis thalianaAT4G11050.1.26.487AT1G64390.1.25.486AT2G32990.1AT1G48930.1.30.491AT2G44550.1
AT2G44540.1AT2G44570.1AT2G44560.1AT1G70710.1AT1G23210.1
AT4G23560.1AT4G39010.1AT3G43860.1AT4G09740.1AT4G39000.1
AT4G02290.1AT1G02800.1AT1G71380.1AT1G22880.1AT1G22880.2
AT4G38990.1
Brachypodium distachyonBradi2g32270.1.30.492Bradi2g07150.1.24.489Bradi4g29640.1Bradi3g36210.1Bradi3g59810.1
Bradi1g44430.1Bradi3g04080.1Bradi5g26010.1Bradi3g34787.1Bradi4g33760.1
Bradi1g54580.1Bradi1g44110.1Bradi2g38357.1Bradi4g35970.1Bradi2g11870.1
Bradi5g11310.1Bradi3g57190.1
Brassica rapaBra027735.24.485Bra027699.25.486Bra005536Bra021821Bra018765.30.491
Bra032270.30.491Bra004844Bra004845Bra004846Bra016192
Bra000354Bra003946Bra024571Bra019296Bra013709
Bra011881Bra011882Bra033591Bra019455Bra033592
Bra036281Bra032584Bra018559Bra012349Bra007982
Bra016143Bra007983Bra034983.33.286Bra034983.33.286
Carica papayaevm.TU.contig_27379.2.24.485evm.model.supercontig_12.254evm.model.supercontig_132.12evm.model.supercontig_19.2evm.model.supercontig_151.20
evm.model.supercontig_2.231evm.model.supercontig_180.8evm.model.supercontig_150.21evm.model.supercontig_126.11evm.model.supercontig_3.308
evm.model.supercontig_21.97evm.model.supercontig_3.307
Capsella rubellaCarubv10003874m.27.488Carubv10019981m.25.486Carubv10022977mCarubv10012624m.30.491Carubv10023082m
Carubv10015060mCarubv10020190mCarubv10007690mCarubv10006388mCarubv10010959m
Carubv10004652mCarubv10006679mCarubv10019329mCarubv10011914mCarubv10000741m
Carubv10011645mCarubv10022009mCarubv10006564m
Citrus clementinaCiclev10019301m.22.483Ciclev10007984mCiclev10014884mCiclev10033912m.95.555Ciclev10023813m
Ciclev10014994mCiclev10019602mCiclev10019799mCiclev10010487mCiclev10004817m
Ciclev10019883mCiclev10028301mCiclev10007163mCiclev10006662mCiclev10004877m
Citrus sinensisorange1.1g009760morange1.1g006835m.22.483orange1.1g036785morange1.1g009690morange1.1g043219m.25.485
orange1.1g042201morange1.1g010632morange1.1g010522morange1.1g037588morange1.1g047277m
orange1.1g048705morange1.1g011252morange1.1g015542morange1.1g012581morange1.1g015354m
orange1.1g016484morange1.1g022932m
Cucumis sativusCucsa.107370.1.24.485Cucsa.303850.1.26.487Cucsa.185030.1Cucsa.042810.1Cucsa.128330.1.26.485
Cucsa.362420.1Cucsa.280220.1Cucsa.055980.1Cucsa.205360.1Cucsa.303540.1
Cucsa.322580.1Cucsa.237360.1Cucsa.096960.1Cucsa.109130.1Cucsa.280220.2
Cucsa.129230.1
Eucalyptus grandisEucgr.D01733.1.31.492Eucgr.E00858.2Eucgr.E00858.1.26.487Eucgr.F00710.1Eucgr.K00765.1
Eucgr.J00862.1.11.469Eucgr.E01717.1Eucgr.E01715.1Eucgr.H01095.1Eucgr.D01675.1
Eucgr.B02944.1Eucgr.D01810.1Eucgr.I01325.1Eucgr.A02886.1Eucgr.F02941.1
Eucgr.A02885.1Eucgr.G01728.1Eucgr.C00736.1
Fragaria vescamrna32087.1-v1.0-hybrid.131.592mrna03442.1-v1.0-hybridmrna01234.1-v1.0-hybridmrna11058.1-v1.0-hybrid.32.492mrna03017.1-v1.0-hybrid
mrna00816.1-v1.0-hybridmrna15488.1-v1.0-hybridmrna31843.1-v1.0-hybridmrna01891.1-v1.0-hybridmrna11076.1-v1.0-hybrid
mrna01563.1-v1.0-hybridmrna31222.1-v1.0-hybridmrna31223.1-v1.0-hybridmrna31225.1-v1.0-hybridmrna21255.1-v1.0-hybrid
mrna21252.1-v1.0-hybridmrna21253.1-v1.0-hybridmrna21254.1-v1.0-hybrid
Glycine maxGlyma05g36930.1.25.486Glyma08g02610.1.26.487Glyma14g02340.1Glyma02g46320.2Glyma02g43680.1
Glyma12g03050.1.27.488Glyma11g10760.1.27.488Glyma14g05200.2Glyma14g05200.3Glyma20g00540.1
Glyma02g01990.1Glyma10g02130.1Glyma03g37420.1Glyma08g04840.1Glyma18g03470.1
Glyma05g34850.1Glyma11g02350.1Glyma04g01030.1Glyma06g01060.2Glyma06g43020.1
Glyma11g11910.3Glyma12g00740.1Glyma06g48140.1Glyma04g12290.1Glyma09g36620.2
Glyma12g00750.1Glyma06g05950.2Glyma06g05950.1Glyma19g40030.2Glyma12g00740.2
Glyma06g43010.2
Gossypium raimondiiGorai.004G133700.4Gorai.004G133700.3Gorai.004G133700.2Gorai.004G133700.1.29.490Gorai.008G254000.2
Gorai.008G254000.1.27.488Gorai.003G080800.4Gorai.003G080800.3Gorai.003G080800.2Gorai.003G080800.1.25.486
Gorai.003G080800.5Gorai.007G170600.2Gorai.007G170600.1Gorai.001G095700.1Gorai.002G092400.1
Gorai.005G210200.2Gorai.005G210200.1.25.485Gorai.002G092400.2Gorai.002G175700.1Gorai.005G160300.1
Gorai.003G077300.1Gorai.010G092700.1Gorai.008G250400.1Gorai.004G286200.1Gorai.013G032600.1
Gorai.007G126900.1Gorai.009G290800.1Gorai.008G031800.1Gorai.001G048100.1Gorai.002G175700.2
Gorai.005G160300.2Gorai.002G175700.4Gorai.002G175700.6Gorai.002G175700.5Gorai.001G048100.2
Linum usitatissimumLus10001833.23.483Lus10032377.23.484Lus10003888.23.484Lus10033957Lus10035316
Lus10009724Lus10010201.33.494Lus10017402.33.467Lus10008208Lus10017525
Lus10029071Lus10031718Lus10001666Lus10018077Lus10042071
Lus10027205Lus10031139Lus10038223Lus10002930Lus10027201
Lus10034199Lus10009794Lus10038075Lus10031090Lus10013418
Lus10010307.109.389Lus10010307.109.389Lus10017338
Malus domesticaMDP0000276676.27.488MDP0000131267.27.488MDP0000289626MDP0000252536MDP0000286362
MDP0000826600.33.492MDP0000561662MDP0000131397MDP0000285589MDP0000188750
MDP0000561477MDP0000740981MDP0000199273MDP0000173809MDP0000130290
MDP0000285057MDP0000276241MDP0000722052.16.241MDP0000269126
Manihot esculentacassava4.1_003698m.27.488cassava4.1_033958mcassava4.1_029944mcassava4.1_008304mcassava4.1_006175m
cassava4.1_006262mcassava4.1_029045mcassava4.1_006236mcassava4.1_023270mcassava4.1_005953m
cassava4.1_006449mcassava4.1_023327mcassava4.1_013066mcassava4.1_023334mcassava4.1_004404m.206.458
cassava4.1_004404m.206.458
Medicago truncatulaMedtr5g085730.1Medtr3g080190.1Medtr4g074960.1.28.515Medtr5g009970.1Medtr8g067400.1
Medtr3g080810.1Medtr5g010000.1Medtr8g104820.1Medtr3g105230.1Medtr5g093590.1.208.568
Medtr5g093590.1.208.568Medtr3g117500.1Medtr3g010330.1Medtr1g088190.1Medtr1g088190.2
Medtr5g009970.2
Mimulus guttatusmgv1a004112mmgv1a004582mmgv1a003302m.29.489mgv1a025805mmgv1a007113m
mgv1a019325mmgv1a005046mmgv1a004581mmgv1a005008mmgv1a020424m
mgv1a021529mmgv1a005384mmgv1a005134mmgv1a004926mmgv1a005277m
mgv1a009571m
Oryza sativaLOC_Os01g12070.1.40.503LOC_Os05g12150.1.34.496LOC_Os01g12030.1.41.508LOC_Os02g50490.1LOC_Os09g23084.1
LOC_Os08g32940.1LOC_Os02g05744.1LOC_Os04g57860.1.38.502LOC_Os01g21070.1LOC_Os08g29770.1
LOC_Os06g14540.1LOC_Os02g03120.1LOC_Os09g36060.1LOC_Os02g50040.1LOC_Os05g03840.1
LOC_Os08g02220.1LOC_Os04g36610.1LOC_Os02g53820.2LOC_Os02g53820.1LOC_Os06g13830.1
Panicum virgatumPavirv00030375m.44.509Pavirv00000152m.37.502Pavirv00000772m.28.493Pavirv00039239mPavirv00045176m
Pavirv00043051mPavirv00029375m.30.493Pavirv00002587mPavirv00022900mPavirv00053329m
Pavirv00016221mPavirv00051185mPavirv00010434mPavirv00039198mPavirv00006123m
Pavirv00025676mPavirv00070574mPavirv00061855mPavirv00039897mPavirv00064504m
Pavirv00052831mPavirv00037663mPavirv00031272mPavirv00047835mPavirv00010413m
Pavirv00008599mPavirv00017496mPavirv00046214mPavirv00047862mPavirv00044358m
Pavirv00006362mPavirv00065946mPavirv00000791m
Physcomitrella patensPp1s37_355V6.1Pp1s149_10V6.1Pp1s176_127V6.1.36.498Pp1s53_97V6.1Pp1s376_19V6.1
Pp1s100_161V6.1Pp1s87_194V6.1Pp1s100_137V6.1Pp1s19_105V6.1Pp1s80_46V6.1
Pp1s170_4V6.1Pp1s100_139V6.1Pp1s20_387V6.1
Phaseolus vulgarisPhvul.002G297600.1.25.486Phvul.008G270900.1Phvul.011G030300.1.27.489Phvul.003G005700.1Phvul.001G239900.1
Phvul.002G160200.1Phvul.007G218400.1Phvul.002G318800.1Phvul.009G003200.1Phvul.001G209500.1
Phvul.011G039400.1Phvul.005G003100.1Phvul.011G005600.1Phvul.009G082800.1Phvul.011G005400.1
Phvul.011G005500.1Phvul.011G005600.2Phvul.008G212700.1
Picea abiesMA_42717g0010.22.483MA_19509g0020.38.501MA_127108g0010.12.464MA_10437098g0010.23.459MA_13829g0010
MA_10430521g0010MA_350239g0010MA_16152g0010MA_140507g0010MA_5355g0010
MA_10431918g0010MA_76986g0010MA_216572g0010MA_14604g0010MA_128094g0010
MA_697188g0010MA_480961g0010MA_182379g0010MA_195523g0010
Populus trichocarpaPotri.003G139600.3Potri.003G139600.2Potri.003G139600.1.27.488Potri.001G092200.3Potri.001G092200.1.27.488
Potri.014G157600.2Potri.014G157600.1Potri.001G356000.1Potri.007G071200.2.27.487Potri.007G071200.1.27.487
Potri.001G092200.2Potri.014G157600.3Potri.010G109200.1Potri.008G132700.1Potri.001G083200.1
Potri.006G219700.1Potri.001G098800.1Potri.015G128000.1Potri.002G202400.1Potri.014G126900.1
Potri.019G069300.1Potri.004G162200.1Potri.019G069300.2Potri.009G123900.1Potri.015G127900.1
Potri.002G202400.2Potri.010G109200.2Potri.003G147600.2Potri.003G147600.1Potri.008G132700.2
Potri.008G132700.3Potri.015G127900.2Potri.002G225200.1
Prunus persicappa002939m.27.488ppa016852mppa004172mppa022524m.32.490ppa021556m
ppa004644mppa025159mppa004653mppa004387mppa004970m
ppa014785mppa005285mppa004719mppa019691mppa026537m
Ricinus communis29762.m00049829948.m00070429675.m000388.28.48829692.m00052530068.m002585
30190.m01127730147.m01420730147.m01420629986.m00164529739.m003631
30131.m007125.25.31530131.m007125.25.315
Setaria italicaSi000642m.41.504Si021474m.29.487Si015134mSi016804mSi006152m
Si021476m.31.495Si016857mSi006422mSi001159mSi016976m
Si013572mSi012639mSi016909mSi006281mSi013602m
Si019460mSi024756mSi030063mSi030488m
Selaginella moellendorffii109529234652.20.48599802.32.50685183234337
117027266914415162
Sorghum bicolorSb09g006670.1.28.493Sb03g001560.1.45.512Sb04g028520.1Sb07g020700.1Sb02g024050.1
Sb04g003690.1Sb06g032760.1.37.501Sb07g019470.1Sb02g030710.1Sb04g028790.1
Sb09g002490.1Sb07g001480.1Sb10g009270.1Sb06g017600.1Sb03g012840.1
Sb04g001960.1Sb04g034920.1Sb10g008880.1
Thellungiella halophilaThhalv10028514m.27.488Thhalv10023353m.24.485Thhalv10016495mThhalv10011318m.30.490Thhalv10027553m
Thhalv10001734mThhalv10018439mThhalv10007462mThhalv10025071mThhalv10027409m
Thhalv10002503mThhalv10027420mThhalv10025010mThhalv10028585mThhalv10007402m
Thhalv10018465mThhalv10001473m
Vitis viniferaGSVIVT01019523001.30.491GSVIVT01012043001.29.489GSVIVT01030494001GSVIVT01037709001GSVIVT01032799001
GSVIVT01032798001GSVIVT01019420001GSVIVT01035481001.517.964GSVIVT01035481001.517.964GSVIVT01035481001.32.475
GSVIVT01035481001.32.475GSVIVT01018619001GSVIVT01028042001GSVIVT01018617001GSVIVT01037210001
GSVIVT01019664001GSVIVT01024179001
Zea maysAC203408.4_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)