y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G186200.4
FamilyCBM45
Protein PropertiesLength: 1472 Molecular Weight: 164766 Isoelectric Point: 7.177
ChromosomeChromosome/Scaffold: 02 Start: 49592453 End: 49606738
DescriptionPyruvate phosphate dikinase, PEP/pyruvate binding domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM454655443.6e-21
  LHWALSEKDGEWLAPPPAVLPPGSVSLEKAAESKFSTSTSGDLPKQVQCIEMEIADGNFKGMPFVLLSGGKWIKNNGSDF
CBM451352106.5e-24
  LHWGAIRGSNDKWVLPSRQPEGTRNHKNRALRTPFVKSGSSSYLKLEIDDPQIQAIEFLIFDEARNKWIKNNGQNF
Full Sequence
Protein Sequence     Length: 1472     Download
MSNSVGQNLI QQHFLRPTVL EHQSKLKGSS GIASNSLCAT ASLNQSLAQP RKYQISTKFY    60
GNSLSKRKHK LAMGSQRPLA FIPQAVLATD PASENLGKFN IDGNIELQVD ASAPTSGSIT    120
NVNFRVMYTS DSLLLHWGAI RGSNDKWVLP SRQPEGTRNH KNRALRTPFV KSGSSSYLKL    180
EIDDPQIQAI EFLIFDEARN KWIKNNGQNF HVKLPQRKTL VSNISVPEDL VQVQAYLRWE    240
RKGKQMYTPE QEKEEYEAAR AELLEEISRG ASVDDIRSKI TKKSGQEYKE TAINEENNKI    300
PDDLVQIQAY IRWEKAGKPN YSPEQQLREF EEARKELQSE LEKGASLDEI RKKITKGEIK    360
TKVAKQLQNK KYFSPERIQR KQRDLMQLLN KHAVKVVEES ISVEVEPKPS TAVEPFAKEK    420
ELDGSPVMNK KIYKLGEKEL LVLVTKPAGK IKIHLATDLE EPLTLHWALS EKDGEWLAPP    480
PAVLPPGSVS LEKAAESKFS TSTSGDLPKQ VQCIEMEIAD GNFKGMPFVL LSGGKWIKNN    540
GSDFYVEFSQ RFKQVQKDAG DGKGTSKVLL DRIAALESEA QKSFMHRFNI ASDLMDQAKN    600
IGELGLAGIL VWMRFMATRQ LIWNRNYNVK PREISKAQDR LTDLLQSIYT THPQHRELLR    660
MIMSTIGRGG EGDVGQRIRD EILVIQRNND CKGGMMEEWH QKLHNNTSPD DVIICQALID    720
YIKSDFDINV YWKTLNENGI TKERLLSYDR AIHSEPSFKR DQKDGLLRDL GHYMRTLKAV    780
HSGADLESAI SNCMGYRAEG QGFMVGVQIN PIPGLPSGFP DLLRFVLEHI EDRNVEALLE    840
GLLEARQELR PLLLKSTGRL KDLLFLDIAL DSTVRTAIER GYEELNNARP EKIMHFITLV    900
LENLALSSDD NEDLVYCLKG WHHSISMCKS KSAHWALYAK SVLDRTRLAL ASKAETYQRI    960
LQPSAEYLGS LLGVDQWAIN IFTEEIIRAG SAATLSSLIN RLDPVLRETA HLGSWQVISP    1020
VEVVGYVEVV DELLSVQNKS YDRPTILVAK SVKGEEEIPD GTIAVLTPDM PDVLSHVSVR    1080
ARNCKVCFAT CFDPNILADL QAKKGKLLRL KPSSADVVYS EVKEGELADS SSSNLKGDGP    1140
SVTLVRKQFV GKYAISAEEF TPEMVGAKSR NISYLKGKVP SWVGIPTSVA LPFGVFEKVL    1200
ADEANKEVDQ KLQILKKKLG EGDFGALEEI RQTVLQLRAP SQLVQELKTK MLTSGMPWPG    1260
DEGEQRWEQA WTAIKKVWAS KWNERAYFST RKVKLDHDYL CMAVLVQEVI NADYAFVIHT    1320
TNPSSGDTSE IYAEVVKGLG ETLVGAYPGR ALSFVCKKNN LNSPEVLGYP SKPIGLFIRR    1380
SMIFRSDSNG EDLEGYAGAG LYDSVPMDKE EKVVVDYSSD PLINDGKFQQ AILSSIAGAG    1440
NAIEELYGSP QDIEGVIRDG KVYVVQTRPQ M*                                  1500
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK06241PRK062413.0e-711561344224+
COG0574PpsA3.0e-1012661469206+
TIGR01418PEP_synth1.0e-1311631470349+
PRK06464PRK064642.0e-1412731469210+
pfam01326PPDK_N1.0e-3311611470336+
Gene Ontology
GO TermDescription
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016310phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK11735.101147111464starch associated protein R1 [Solanum tuberosum]
Swiss-ProtQ8LPT901147111475GWD1_CITRE RecName: Full=Alpha-glucan water dikinase, chloroplastic; AltName: Full=Starch-related protein R1; Flags: Precursor
RefSeqXP_002270485.101147111470PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315679.10121471171477predicted protein [Populus trichocarpa]
RefSeqXP_002527902.101147111469alpha-glucan water dikinase, chloroplast precursor, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77752389857714720
HO79439875272314720
HO7943981425827230
CO082451294107013630
CO072750291113714270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00059.2.125.200Aquca_002_00059.2.125.200Aquca_002_00059.1.125.200Aquca_002_00059.1.125.200Aquca_010_00076.4
Aquca_010_00076.3Aquca_010_00076.2Aquca_010_00076.1Aquca_002_00499.4.322.398Aquca_002_00499.4.322.398
Aquca_002_00499.3.322.398Aquca_002_00499.3.322.398Aquca_002_00499.2.322.398Aquca_002_00499.2.322.398Aquca_002_00499.1.322.398
Aquca_002_00499.1.322.398Aquca_002_00059.3Aquca_002_00059.2.379.458Aquca_002_00059.2.379.458Aquca_002_00059.1.379.458
Aquca_002_00059.1.379.458Aquca_002_00499.4.126.212Aquca_002_00499.4.126.212Aquca_002_00499.3.126.212Aquca_002_00499.3.126.212
Aquca_002_00499.2.126.212Aquca_002_00499.2.126.212Aquca_002_00499.1.126.212Aquca_002_00499.1.126.212
Arabidopsis lyrata888368.117.192888368.117.192339218.127.210888368.391.469888368.391.469
492401
Arabidopsis thalianaAT1G10760.1.120.195AT1G10760.1.120.195AT1G69830.1.305.381AT1G69830.1.305.381AT1G69830.1.126.209
AT1G69830.1.126.209AT1G10760.1.394.472AT1G10760.1.394.472AT4G24450.1
Brachypodium distachyonBradi1g41907.2.109.184Bradi1g41907.2.109.184Bradi1g41907.1.109.184Bradi1g41907.1.109.184Bradi3g11270.1
Bradi2g48150.1.119.204Bradi2g48150.1.119.204Bradi1g41907.2.447.524Bradi1g41907.2.447.524Bradi1g41907.1.447.524
Bradi1g41907.1.447.524Bradi2g48150.1.299.375Bradi2g48150.1.299.375
Brassica rapaBra031749Bra018423.116.191Bra018423.116.191Bra016262.314.390Bra016262.314.390
Bra016262.127.210Bra016262.127.210Bra018423.389.467Bra018423.389.467Bra013803
Carica papayaevm.model.supercontig_69.90evm.model.supercontig_5.271.119.202
Capsella rubellaCarubv10008131mCarubv10019759m.318.394Carubv10019759m.318.394Carubv10019759m.133.214Carubv10019759m.133.214
Carubv10006877m
Citrus clementinaCiclev10030521mCiclev10030520mCiclev10030501mCiclev10030500mCiclev10030499m
Ciclev10030780m.171.247Ciclev10030661m.319.395Ciclev10030661m.319.395Ciclev10017434mCiclev10030661m.128.211
Ciclev10030661m.128.211
Citrus sinensisorange1.1g006158m.75.151orange1.1g004353m.317.393orange1.1g004353m.317.393orange1.1g003698m.219.295orange1.1g003698m.219.295
orange1.1g003613m.317.393orange1.1g003613m.317.393orange1.1g003004m.317.393orange1.1g003004m.317.393orange1.1g002611m.317.393
orange1.1g002611m.317.393orange1.1g002585m.317.393orange1.1g002585m.317.393orange1.1g001903morange1.1g001677m
orange1.1g001333morange1.1g001268morange1.1g001019morange1.1g004353m.126.209orange1.1g004353m.126.209
orange1.1g003698m.28.111orange1.1g003698m.28.111orange1.1g003613m.126.209orange1.1g003613m.126.209orange1.1g003004m.126.209
orange1.1g003004m.126.209orange1.1g002611m.126.209orange1.1g002611m.126.209orange1.1g002585m.126.209orange1.1g002585m.126.209
Cucumis sativusCucsa.286300.3Cucsa.286300.2Cucsa.286300.1Cucsa.285330.2.172.248Cucsa.285330.1.312.388
Cucsa.285330.1.312.388Cucsa.285330.1.120.205Cucsa.285330.1.120.205
Eucalyptus grandisEucgr.H02531.2.128.203Eucgr.H02531.2.128.203Eucgr.H02531.1.128.203Eucgr.H02531.1.128.203Eucgr.G02543.2.332.409
Eucgr.G02543.2.332.409Eucgr.G02543.1.332.409Eucgr.G02543.1.332.409Eucgr.H02531.2.459.539Eucgr.H02531.2.459.539
Eucgr.H02531.1.459.539Eucgr.H02531.1.459.539Eucgr.G02543.2.138.224Eucgr.G02543.2.138.224Eucgr.G02543.1.138.224
Eucgr.G02543.1.138.224
Fragaria vescamrna03581.1-v1.0-hybrid
Glycine maxGlyma08g39110.2.123.198Glyma08g39110.2.123.198Glyma08g39110.1.123.198Glyma08g39110.1.123.198Glyma18g20600.2.123.198
Glyma18g20600.2.123.198Glyma02g02450.1.313.389Glyma02g02450.1.313.389Glyma08g39110.2.452.531Glyma08g39110.2.452.531
Glyma08g39110.1.452.531Glyma08g39110.1.452.531Glyma18g20600.2.452.531Glyma18g20600.2.452.531Glyma08g40810.1.133.219
Glyma08g40810.1.133.219Glyma08g40810.1.327.403Glyma08g40810.1.327.403Glyma04g10375.2Glyma04g10375.1
Glyma02g02450.1.120.206Glyma02g02450.1.120.206
Gossypium raimondiiGorai.002G186200.7.135.210Gorai.002G186200.7.135.210Gorai.002G186200.6.121.196Gorai.002G186200.6.121.196Gorai.002G186200.5.135.210
Gorai.002G186200.5.135.210Gorai.002G186200.4.135.210Gorai.002G186200.4.135.210Gorai.002G186200.3.135.210Gorai.002G186200.3.135.210
Gorai.002G186200.2.135.210Gorai.002G186200.2.135.210Gorai.002G186200.1.136.211Gorai.002G186200.1.136.211Gorai.008G160400.2
Gorai.008G160400.1Gorai.002G186200.8Gorai.002G186200.7.465.544Gorai.002G186200.7.465.544Gorai.002G186200.6.451.530
Gorai.002G186200.6.451.530Gorai.002G186200.5.465.544Gorai.002G186200.5.465.544Gorai.002G186200.4.465.544Gorai.002G186200.4.465.544
Gorai.002G186200.3.465.544Gorai.002G186200.3.465.544Gorai.002G186200.2.465.544Gorai.002G186200.2.465.544Gorai.002G186200.1.466.545
Gorai.002G186200.1.466.545Gorai.008G182600.7Gorai.008G182600.6.125.208Gorai.008G182600.5.125.208Gorai.008G182600.4.125.208
Gorai.008G182600.3.123.206Gorai.008G182600.2.125.208Gorai.008G182600.1.125.208
Linum usitatissimumLus10013044.135.210Lus10013044.135.210Lus10029118.135.210Lus10029118.135.210Lus10036717.126.209
Lus10036717.126.209Lus10030793.133.216Lus10030793.133.216Lus10013270.136.219Lus10013270.136.219
Lus10037211.126.209Lus10037211.126.209Lus10030793.315.391Lus10030793.315.391Lus10013270.318.394
Lus10013270.318.394Lus10037211.305.381Lus10037211.305.381Lus10036717.305.381Lus10036717.305.381
Lus10029118.445.523Lus10029118.445.523Lus10013044.463.541Lus10013044.463.541Lus10032829
Malus domesticaMDP0000252405.192.267MDP0000252405.192.267MDP0000951961.54.127MDP0000951961.54.127MDP0000951961.323.402
MDP0000951961.323.402MDP0000252405.478.557MDP0000252405.478.557
Manihot esculentacassava4.1_000266m.133.208cassava4.1_000266m.133.208cassava4.1_004613m.310.386cassava4.1_004613m.310.386cassava4.1_000266m.404.482
cassava4.1_000266m.404.482cassava4.1_004613m.121.204cassava4.1_004613m.121.204cassava4.1_001555m.120.203cassava4.1_001362m.120.203
Mimulus guttatusmgv1a000186mmgv1a000185mmgv1a001104m.306.382mgv1a001104m.306.382mgv1a001104m.125.211
mgv1a001104m.125.211
Oryza sativaLOC_Os01g51754.4LOC_Os01g51754.3
Panicum virgatumPavirv00036852m.113.188Pavirv00036852m.113.188Pavirv00030888m.120.203Pavirv00030888m.120.203Pavirv00061832m.120.203
Pavirv00061832m.120.203Pavirv00036852m.456.533Pavirv00036852m.456.533Pavirv00061832m.304.382Pavirv00061832m.304.382
Pavirv00030888m.304.382Pavirv00030888m.304.382
Phaseolus vulgarisPhvul.003G062900.1.120.195Phvul.003G062900.1.120.195Phvul.002G065700.1.313.389Phvul.002G065700.1.313.389Phvul.003G062900.1.449.528
Phvul.003G062900.1.449.528Phvul.003G069200.1.132.218Phvul.003G069200.1.132.218Phvul.003G069200.1.326.402Phvul.003G069200.1.326.402
Phvul.002G065700.1.119.205Phvul.002G065700.1.119.205
Picea abiesMA_50250g0010MA_108710g0010MA_72129g0020
Populus trichocarpaPotri.010G044100.4.130.205Potri.010G044100.4.130.205Potri.010G044100.3Potri.010G044100.2Potri.010G044100.1
Potri.008G188200.2Potri.008G188200.1Potri.010G092900.9.140.223Potri.010G092900.9.140.223Potri.010G092900.8.140.223
Potri.010G092900.8.140.223Potri.010G092900.6.140.223Potri.010G092900.6.140.223Potri.010G092900.5.140.223Potri.010G092900.5.140.223
Potri.010G092900.4.140.223Potri.010G092900.4.140.223Potri.010G092900.3.140.223Potri.010G092900.3.140.223Potri.010G092900.2.140.223
Potri.010G092900.2.140.223Potri.010G092900.1.140.223Potri.010G092900.1.140.223Potri.010G092900.9.331.407Potri.010G092900.9.331.407
Potri.010G092900.8.331.407Potri.010G092900.8.331.407Potri.010G092900.6.331.407Potri.010G092900.6.331.407Potri.010G092900.5.320.396
Potri.010G092900.5.320.396Potri.010G092900.4.316.392Potri.010G092900.4.316.392Potri.010G092900.3.331.407Potri.010G092900.3.331.407
Potri.010G092900.2.327.403Potri.010G092900.2.327.403Potri.010G092900.1.331.407Potri.010G092900.1.331.407Potri.010G044100.4.469.548
Potri.010G044100.4.469.548
Prunus persicappa000209m.127.202ppa000209m.127.202ppa001575m.213.289ppa000209m.462.540ppa000209m.462.540
Ricinus communis27504.m000617.131.20627504.m000617.131.20629736.m002033.124.20729736.m002033.124.20729736.m002033.313.389
29736.m002033.313.38927504.m000617.462.54127504.m000617.462.541
Setaria italicaSi005690m.113.188Si005690m.113.188Si000308m.120.203Si000308m.120.203Si000258m.120.203
Si000258m.120.203Si005690m.456.533Si005690m.456.533Si000308m.304.382Si000308m.304.382
Si000258m.304.382Si000258m.304.382
Sorghum bicolorSb10g017820.1.117.192Sb10g017820.1.117.192Sb03g032830.1.58.143Sb03g032830.1.58.143Sb10g017820.1.460.537
Sb10g017820.1.460.537Sb03g032830.1.241.319Sb03g032830.1.241.319
Thellungiella halophilaThhalv10006578mThhalv10006565mThhalv10018099m.133.216Thhalv10018099m.133.216Thhalv10018099m.318.394
Thhalv10018099m.318.394Thhalv10024230m
Vitis viniferaGSVIVT01013806001GSVIVT01020069001.305.381GSVIVT01020069001.305.381GSVIVT01020069001.117.203GSVIVT01020069001.117.203
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)