y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G190500.1
FamilyCE10
Protein PropertiesLength: 402 Molecular Weight: 44557.1 Isoelectric Point: 6.8975
ChromosomeChromosome/Scaffold: 02 Start: 51431309 End: 51433913
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10703910
  CIRIFLPAMVVNFDPTKIIEDKSKDGAFIYSGYSPQAGTKHKKLPVVLQFHGGAFVGGSNDSVRNDAFCRRIANLCDVIVVAVGYRLAPESRYPAAFDDG
  LKVLNWLAKEANLAECGKWMGNGNGRRRADAHVFDGFGASMAEPWLAAHGDPSRCVLLGVSSGANIADYVARKAVEAGKLLDPVKVVAQVLMYPFFIGSN
  PTASEIKLANSYFYDKSVCMQTWKLFLPEEKFDLDHPAANPLIPGREPPLKFMPPTLTVVAEQDWMRDRAIAYSEELRRANIDAPLLEYKDAVHEFATLD
  VLLQTPQAQACAEDIAIWVKKY
Full Sequence
Protein Sequence     Length: 402     Download
MPSLAVKLYS IFFKFQQRYM LHNLTQNPVH AVDPFGITSR HEESTAASNP SFYEGVATKD    60
IHIDPFSSLC IRIFLPAMVV NFDPTKIIED KSKDGAFIYS GYSPQAGTKH KKLPVVLQFH    120
GGAFVGGSND SVRNDAFCRR IANLCDVIVV AVGYRLAPES RYPAAFDDGL KVLNWLAKEA    180
NLAECGKWMG NGNGRRRADA HVFDGFGASM AEPWLAAHGD PSRCVLLGVS SGANIADYVA    240
RKAVEAGKLL DPVKVVAQVL MYPFFIGSNP TASEIKLANS YFYDKSVCMQ TWKLFLPEEK    300
FDLDHPAANP LIPGREPPLK FMPPTLTVVA EQDWMRDRAI AYSEELRRAN IDAPLLEYKD    360
AVHEFATLDV LLQTPQAQAC AEDIAIWVKK YISLRGHEFS Y*                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00135COesterase3.0e-610215857+
cd00312Esterase_lipase3.0e-6102233141+
PRK10162PRK101622.0e-610218180+
COG0657Aes3.0e-35110385277+
pfam07859Abhydrolase_39.0e-59116366251+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001030781.1014011428hydrolase [Arabidopsis thaliana]
RefSeqXP_002267130.1014011425PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002311735.1014011387predicted protein [Populus trichocarpa]
RefSeqXP_002311736.1014011388predicted protein [Populus trichocarpa]
RefSeqXP_002515006.1014011391catalytic, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A2e-403436844331A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2zsh_A2e-403436844331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F2e-335436860330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E2e-335436860330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D2e-335436860330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES789976318954020
DT54685024212400
DT4853432771264020
EB4388452791314020
GO3625233031013920
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.001G268100.1Gorai.011G093200.1
Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny