y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G225800.1
FamilyGH51
Protein PropertiesLength: 709 Molecular Weight: 78376.3 Isoelectric Point: 5.1204
ChromosomeChromosome/Scaffold: 02 Start: 58166111 End: 58176967
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512536890
  TTSKNGVVWFDQVSAMPLDTYKGHGFRNELAEMLADIKPRFIRFPGGCFVEGEWLRNAFRWKASVGPWEERPGHFGDVWMYWTDDGLGYFEFLQLAEDLG
  ALPIWVFNNGISHNDQVDTSSVLPFVQEALDGIEFARGDASSTWGSVRAAMGHPEPFDLKYVAIGNEDCGKKNYRGNYLKFYDAIKRTYPDIKIITNCDG
  SSLPLDHPTDLYDFHVYTSANNLFSMSHKFDRTTRQGPKAFVSEYAVTGKDAGTGSLLAALAEAAFLIGLEKNSDVVHMASYAPLFVNSNDRRWNPDAIV
  FNSFQVYGTPSYWVQRFFTESSGATLLNATLQKDSSNSLVASAITWKNSEDGQTYIRIKVVNFGSNSVNLQISVDGLDPNSVKLSGSTKTTLTSANLMDE
  NSFKEPKKVAPNQTLLEDAQEMSALLRPHSFTSFDLL
Full Sequence
Protein Sequence     Length: 709     Download
MLIASSHHSQ YFHLIWVSLL FLFRSQSVCA VSKAMGYCKA PCVFLLCLFI SFCLPRQLLA    60
DEVDKNLTAQ LFIDASEQSS RPIPQTLFGI FFEEINHAGA GGLWAELVSN RGFEAGGANI    120
PSNIDPWSII GDESSIIVST DRSSCFERNK VALKMEVLCN TDGTHICPSG GVGIYNPGFW    180
GMNIEQGKSY KIVFYVRSTG AIDISVSFTS SDGLQTLSST NIKASASDVS NWTKMEVLLE    240
AKETNHNSRL QLTTSKNGVV WFDQVSAMPL DTYKGHGFRN ELAEMLADIK PRFIRFPGGC    300
FVEGEWLRNA FRWKASVGPW EERPGHFGDV WMYWTDDGLG YFEFLQLAED LGALPIWVFN    360
NGISHNDQVD TSSVLPFVQE ALDGIEFARG DASSTWGSVR AAMGHPEPFD LKYVAIGNED    420
CGKKNYRGNY LKFYDAIKRT YPDIKIITNC DGSSLPLDHP TDLYDFHVYT SANNLFSMSH    480
KFDRTTRQGP KAFVSEYAVT GKDAGTGSLL AALAEAAFLI GLEKNSDVVH MASYAPLFVN    540
SNDRRWNPDA IVFNSFQVYG TPSYWVQRFF TESSGATLLN ATLQKDSSNS LVASAITWKN    600
SEDGQTYIRI KVVNFGSNSV NLQISVDGLD PNSVKLSGST KTTLTSANLM DENSFKEPKK    660
VAPNQTLLED AQEMSALLRP HSFTSFDLLK ESVSLRITED DSSLVSSI*                720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06964Alpha-L-AF_C3.0e-29523682170+
COG3534AbfA2.0e-30277424153+
smart00813Alpha-L-AF_C2.0e-35523682166+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.10357081675alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABF22680.305370818677alpha-L-arabinofuranosidase [Prunus persica]
GenBankABV32544.105370818677alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAF42035.10357081675alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002523672.106070831678Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ug5_F5e-1927768868501A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB3ug5_E5e-1927768868501A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB3ug5_D5e-1927768868501A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB3ug5_C5e-1927768868501A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB3ug5_B5e-1927768868501A Chain A, Raphanus Sativus Anionic Peroxidase.
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO127112283203020
HO8526834152776880
HO7807404043057070
CO1020892862785630
ES8353912821524330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)