y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G225800.3
FamilyGH51
Protein PropertiesLength: 674 Molecular Weight: 74357.6 Isoelectric Point: 4.8708
ChromosomeChromosome/Scaffold: 02 Start: 58166179 End: 58176525
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512196540
  TTSKNGVVWFDQVSAMPLDTYKGHGFRNELAEMLADIKPRFIRFPGGCFVEGEWLRNAFRWKASVGPWEERPGHFGDVWMYWTDDGLGYFEFLQLAEDLG
  ALPIWVFNNGISHNDQVDTSSVLPFVQALDGIEFARGDASSTWGSVRAAMGHPEPFDLKYVAIGNEDCGKKNYRGNYLKFYDAIKRTYPDIKIITNCDGS
  SLPLDHPTDLYDFHVYTSANNLFSMSHKFDRTTRQGPKAFVSEYAVTGKDAGTGSLLAALAEAAFLIGLEKNSDVVHMASYAPLFVNSNDRRWNPDAIVF
  NSFQVYGTPSYWVQRFFTESSGATLLNATLQKDSSNSLVASAITWKNSEDGQTYIRIKVVNFGSNSVNLQISVDGLDPNSVKLSGSTKTTLTSANLMDEN
  SFKEPKKVAPNQTLLEDAQEMSALLRPHSFTSFDLL
Full Sequence
Protein Sequence     Length: 674     Download
MGYCKAPCVF LLCLFISFCL PRQLLADEVD KNLTAQLFID ASEQSSRPIP QTLFGIFFEE    60
INHAGAGGLW AELVSNRGFE AGGANIPSNI DPWSIIGDES SIIVSTDRSS CFERNKVALK    120
MEVLCNTDGT HICPSGGVGI YNPGFWGMNI EQGKSYKIVF YVRSTGAIDI SVSFTSSDGL    180
QTLSSTNIKA SASDVSNWTK MEVLLEAKET NHNSRLQLTT SKNGVVWFDQ VSAMPLDTYK    240
GHGFRNELAE MLADIKPRFI RFPGGCFVEG EWLRNAFRWK ASVGPWEERP GHFGDVWMYW    300
TDDGLGYFEF LQLAEDLGAL PIWVFNNGIS HNDQVDTSSV LPFVQALDGI EFARGDASST    360
WGSVRAAMGH PEPFDLKYVA IGNEDCGKKN YRGNYLKFYD AIKRTYPDIK IITNCDGSSL    420
PLDHPTDLYD FHVYTSANNL FSMSHKFDRT TRQGPKAFVS EYAVTGKDAG TGSLLAALAE    480
AAFLIGLEKN SDVVHMASYA PLFVNSNDRR WNPDAIVFNS FQVYGTPSYW VQRFFTESSG    540
ATLLNATLQK DSSNSLVASA ITWKNSEDGQ TYIRIKVVNF GSNSVNLQIS VDGLDPNSVK    600
LSGSTKTTLT SANLMDENSF KEPKKVAPNQ TLLEDAQEMS ALLRPHSFTS FDLLKESVSL    660
RITEDDSSLV SSI*                                                      720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA9.0e-29243389152+
pfam06964Alpha-L-AF_C3.0e-29488647170+
smart00813Alpha-L-AF_C1.0e-35488647166+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF22680.301967318677alpha-L-arabinofuranosidase [Prunus persica]
GenBankABV32544.101967318677alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAF42035.1016731675alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002307940.1016731670predicted protein [Populus trichocarpa]
RefSeqXP_002523672.102667331678Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4atw_F7e-1924365348481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_E7e-1924365348481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_D7e-1924365348481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_C7e-1924365348481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_B7e-1924365348481A Chain A, The Crystal Structure Of Arabinofuranosidase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8526834152436530
CO12711226812680
ES8353912821183980
HO7807404042716720
CO1020892862445280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)