y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G227600.2
FamilyCE1
Protein PropertiesLength: 229 Molecular Weight: 25694.2 Isoelectric Point: 7.7076
ChromosomeChromosome/Scaffold: 02 Start: 58625909 End: 58631806
DescriptionS-formylglutathione hydrolase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1251702.7e-35
  SPTLGCSMTFHIYFPPSSSPSHKFPILYWLSGLTCTDENFIIKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQQKWKNWRMYD
  YVVKELPKLLSENFPQLDTSKASISGHSMGGHGALTIYLKNLDKYK
Full Sequence
Protein Sequence     Length: 229     Download
METKPTEIGS SKMFGGYNKR YKHFSPTLGC SMTFHIYFPP SSSPSHKFPI LYWLSGLTCT    60
DENFIIKSGA QRAASAEGVA LIAPDTSPRG LNVEGEADSW DFGVGAGFYL NATQQKWKNW    120
RMYDYVVKEL PKLLSENFPQ LDTSKASISG HSMGGHGALT IYLKNLDKYK GEDDKFLDQL    180
LAHKFEEACR SVNVPLLLRL QPGYDHSYFF ISTFIDDHIR HHAQALKL*                240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0627COG06279.0e-1517122860+
pfam00756Esterase6.0e-3025221257+
COG0627COG06279.0e-411170177+
TIGR02821fghA_ester_D5.0e-908226275+
PLN02442PLN024423.0e-1531228284+
Gene Ontology
GO TermDescription
GO:0004091carboxylesterase activity
GO:0016023cytoplasmic membrane-bounded vesicle
GO:0018738S-formylglutathione hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65175.10132281272putative esterase D [Arabidopsis thaliana]
GenBankACJ11734.1012281284S-formylglutathione hydrolase [Gossypium hirsutum]
GenBankACU19052.1012281284unknown [Glycine max]
RefSeqNP_181684.1012281284SFGH (S-FORMYLGLUTATHIONE HYDROLASE); S-formylglutathione hydrolase/ hydrolase, acting on ester bonds [Arabidopsis thaliana]
RefSeqXP_002284489.1012281284PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fcx_B072265280A Chain A, Crystal Structure Of Human Esterase D
PDB3fcx_A072265280A Chain A, Crystal Structure Of Human Esterase D
PDB3s8y_A082277279A Chain A, Bromide Soaked Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_B082277279A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_A082277279A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES83949128412290
DT54915228312270
ES80779028512290
ES84176228012240
ES82817928212260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00724.1Aquca_014_00724.3Aquca_014_00724.2
Arabidopsis lyrata903473
Arabidopsis thalianaAT2G41530.1
Brachypodium distachyonBradi2g60400.1
Brassica rapaBra000230Bra004627
Carica papayaevm.model.supercontig_182.15
Capsella rubellaCarubv10023793m
Chlamydomonas reinhardtiiCre03.g158800.t3.1Cre03.g158800.t1.3Cre03.g158800.t2.1
Citrus clementinaCiclev10005572m
Citrus sinensisorange1.1g023324morange1.1g024077m
Eucalyptus grandisEucgr.K02019.2Eucgr.K01713.1Eucgr.K02019.1
Fragaria vescamrna21972.1-v1.0-hybrid
Glycine maxGlyma10g15910.1Glyma02g33350.1
Gossypium raimondiiGorai.002G227600.1Gorai.002G227600.3
Linum usitatissimumLus10031051Lus10035437Lus10042038
Malus domesticaMDP0000130742MDP0000878750
Manihot esculentacassava4.1_014031mcassava4.1_013351m
Mimulus guttatusmgv1a011293m
Oryza sativaLOC_Os01g71300.2LOC_Os01g71300.1
Panicum virgatumPavirv00039463mPavirv00031885m
Physcomitrella patensPp1s61_17V6.4Pp1s61_17V6.5Pp1s61_17V6.3Pp1s61_17V6.2Pp1s61_17V6.1
Phaseolus vulgarisPhvul.007G250500.1
Picea abiesMA_348109g0010
Populus trichocarpaPotri.006G047000.5Potri.006G047000.1Potri.006G047000.2Potri.006G047000.3Potri.006G047000.4
Prunus persicappa009542m
Ricinus communis29840.m000625
Setaria italicaSi001977mSi023477m
Selaginella moellendorffii151094
Sorghum bicolorSb03g045400.1
Thellungiella halophilaThhalv10017045m
Vitis viniferaGSVIVT01033232001
Volvox carteriVocar20000681m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny