y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G227900.1
FamilyGT1
Protein PropertiesLength: 461 Molecular Weight: 51807.3 Isoelectric Point: 7.0351
ChromosomeChromosome/Scaffold: 02 Start: 58642902 End: 58644284
DescriptionUDP-glycosyltransferase 73B4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12484367.8e-37
  GSRHYCLEWLDKQEMNSVLYVSFGTTTTMGDEQIQELAIGLRRSNQKFIWVLRDADTGDVFNGEVRRPELPKGYQDSVKDKGLVVRDWAPQLEILAHPAI
  GGFVSHCGWNSCMESITMGVPIGAWPVHSDQPRNAVLITKLLKLGITIKDWARRDEVVTAAVVEDAVKRLMASKEGDEIRKRAAEVSGA
Full Sequence
Protein Sequence     Length: 461     Download
MTNQENSVIV VMVPFPAQGH LNQLLHLSRI ILSYGIPVHY VGTSTHNRQA KVRVHGWDPV    60
AVASFHFHDC QVPPFASPPP NPNAAIKFPS HLQPCFDACH YLRKPVTELL RMLSSQARKV    120
VIIHDSMMGS VVQDVGSILN TESYAFHTVS AFSLFFYLWE STGKPQVNAE MLGENDVPSL    180
EGCFTEDFLE FIALQHRYLN VTSGSIYNTS KVIECTYVEL LRQHMKEKQH WALGPFNPLK    240
VPEKNSCGSR HYCLEWLDKQ EMNSVLYVSF GTTTTMGDEQ IQELAIGLRR SNQKFIWVLR    300
DADTGDVFNG EVRRPELPKG YQDSVKDKGL VVRDWAPQLE ILAHPAIGGF VSHCGWNSCM    360
ESITMGVPIG AWPVHSDQPR NAVLITKLLK LGITIKDWAR RDEVVTAAVV EDAVKRLMAS    420
KEGDEIRKRA AEVSGAVRQS VAEGEVYRKE WDSFITHIIR *                        480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03007PLN030079.0e-42202455265+
PLN02863PLN028633.0e-4310460494+
PLN00164PLN001643.0e-44251444207+
PLN02448PLN024485.0e-45105458378+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002284381.10446013473PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308926.10345816471predicted protein [Populus trichocarpa]
RefSeqXP_002308931.10445817471predicted protein [Populus trichocarpa]
RefSeqXP_002322723.10124601452predicted protein [Populus trichocarpa]
RefSeqXP_002532135.10445820485UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A4.06377e-44127436118445A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB2vch_A4.06377e-44127436118445A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB2vce_A4.06377e-44127436118445A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B2e-3914443447A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A2e-3914443447A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63125246354610
BF2759542851494330
ES808732197562520
AI725458197382340
DY27235535213370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)