y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G235100.1
FamilyGT4
Protein PropertiesLength: 793 Molecular Weight: 89655.9 Isoelectric Point: 7.7268
ChromosomeChromosome/Scaffold: 02 Start: 59555124 End: 59562274
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45496518.2e-21
  AYFLGKMVWAKGYKELIDLLAKHKNDLDGFKLDVYGNGEDAHEVQSTAKRLNLNLNFLKGRDHADDSLHGYKIFINPSVSDVLCTATAEALAMGKFVVCA
  DHP
Full Sequence
Protein Sequence     Length: 793     Download
MDKGSQTTAA VVATTTTTTS NSSAFSFISK GWREVRDSAD ADLQLMKDRA NTFKNLAASF    60
DREIENLIQS ATPTFSVPAI RQSSEIDFMK KLQPKISEFR RVYSAPEISR RVMEKWGPRA    120
KLGIDLSRIR SAIVAEVDET EEEDMYGIVE FNKFKKGRRA RFTEEGQFGD WEPIRALKTR    180
LREFEKKNAS VEIFGGFKNS EFVEKVKSSL KAIIKEPQES KDVPALDVPE LLAYLVRQSG    240
PFLDQLGVRR DLCDKIVESL CSKRKNQLVL RSLAEGEPPT VDGDKINDEL DLRIASVLQS    300
TGHCYEGGFW TDFVKHDVSD GKRHVAIVTT ASLPWMTGTA VNPLFRAAYL AKSAKQKVTL    360
LVPWLCRSDQ ELVYPNNLTF SSPEEQENYI RNWLEERTGF KADFKISFYP GKFSKERRSI    420
IPAGDTSQFI PSKDADICIL EEPEHLNWYH HGKRWTDKFN HVVGIVHTNY LEYIKREKNG    480
ALQAFLVKHI NNWVTRAYCH KVLRLSAATQ DLPKSVICNV HGVNPKFLKI GEKVAEEREL    540
GQQAFSKEAY FLGKMVWAKG YKELIDLLAK HKNDLDGFKL DVYGNGEDAH EVQSTAKRLN    600
LNLNFLKGRD HADDSLHGYK IFINPSVSDV LCTATAEALA MGKFVVCADH PSNEFFRSFP    660
NCLTYKSSED FVAKVKEALA NEPQPLTPEQ IYNLSWEAAT QRFVEYSELD RVLNNRHNPA    720
KVGSKIIAKS SSLPNLSEIV DGGLAFAHYC LTGNELLRLC TGAIPGTRDY DKQHCKDLHL    780
LPPQVENPIY GW*                                                       840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00534Glycos_transf_14.0e-11551683140+
COG0438RfaG1.0e-11443716294+
TIGR00032argG8.0e-13406682311+
PLN02501PLN02501020792790+
PLN02846PLN028460322783462+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA55727.10127921780digalactosyldiacylglycerol synthase 1 [Vigna unguiculata]
Swiss-ProtQ6DW740127921786DGDG1_LOTJA RecName: Full=Digalactosyldiacylglycerol synthase 1, chloroplastic; Flags: Precursor
RefSeqXP_002264659.101979217797PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323386.10117923793predicted protein [Populus trichocarpa]
RefSeqXP_002533901.10177925797galactolipid galactosyltransferase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7953934043947930
ES8130553842756540
GO8500173333156470
ES818203340203570
JG4521502864857700
Orthologous Group
SpeciesID
Arabidopsis lyrata897369490510
Arabidopsis thalianaAT4G00550.1AT3G11670.1
Brachypodium distachyonBradi1g66940.1
Brassica rapaBra034821
Glycine maxGlyma19g38720.1
Manihot esculentacassava4.1_001948mcassava4.1_004529m
Mimulus guttatusmgv1a001509m
Panicum virgatumPavirv00006441m
Populus trichocarpaPotri.016G070200.2Potri.016G070200.1Potri.006G203200.4Potri.006G203200.3
Setaria italicaSi026023mSi026022m
Sorghum bicolorSb05g003730.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny