y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G238200.1
FamilyGT41
Protein PropertiesLength: 928 Molecular Weight: 103024 Isoelectric Point: 5.7095
ChromosomeChromosome/Scaffold: 02 Start: 60152274 End: 60159929
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413628520
  IKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNITMAVTAYEQCLKIDPDSRNAGQNRLLAMNYINEGDDDKLFEAHR
  DWGRRFMRLYPQYDSWDNPKDPERPLVIGYISPDYFTHSVSYFIEAPLIYHDYGKYQVVVYSAVVKADAKTNRFRERVVKKGGLWRDIYGIDEKKVASMI
  RDDKIDILVELTGHTANNKLGTMACRPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPGTKQKHVEELVRLPECFLCYTPSSEAGLVSPTPALSNGFITF
  GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRQKFLTTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG
  VPCVTMAGSVHAHNVGVSLLSKVGLGHLIAKNEDEYVQLALQLASDVTALQNLRASLRDLMSKSPVCDGQNFISGLEATYRGMWRRYCKGD
Full Sequence
Protein Sequence     Length: 928     Download
MAWTEKDVNG REKDLIAENG FLKDRQSSPG PSTSTVDVIP PPKAFEGKDA LSYANILRSR    60
NKFVDALAIY NSVLEKDSGC VEAYIGKGIC LQMQNMGRPA FESFAEAIKL DPQNACALTH    120
CGILYKDEGR LVDAAESYQK ALKADASYKP AAECLAIVLT DLGTSLKLAG NTQEGIQKYY    180
EALKIDPHYA PAYYNLGVVY SEMMQYDTAL SCYEKAALER PMYAEAYCNM GVIYKNRGDL    240
ESAIACYERC LAVSPNFEIA KNNMAIALTD LGTKVKLEGD INQGVAYYKK ALYYNWHYAD    300
AMYNLGVAYG EMLKFDMAVV FYELAFHFNP HCAEACNNLG VIYKDRDNLD KAVECYQLAL    360
SIKPNFSQSL NNLGVVYTVQ GKMDAAASMI EKAIIANPTY AEAYNNLGVL YRDAGNITMA    420
VTAYEQCLKI DPDSRNAGQN RLLAMNYINE GDDDKLFEAH RDWGRRFMRL YPQYDSWDNP    480
KDPERPLVIG YISPDYFTHS VSYFIEAPLI YHDYGKYQVV VYSAVVKADA KTNRFRERVV    540
KKGGLWRDIY GIDEKKVASM IRDDKIDILV ELTGHTANNK LGTMACRPAP VQVTWIGYPN    600
TTGLPTIDYR ITDSLADPPG TKQKHVEELV RLPECFLCYT PSSEAGLVSP TPALSNGFIT    660
FGSFNNLAKI TPKVLQVWAR ILCAVPNSRL VVKCKPFCCD SVRQKFLTTL EQLGLESLRV    720
DLLPLILLNH DHMQAYSLMD ISLDTFPYAG TTTTCESLYM GVPCVTMAGS VHAHNVGVSL    780
LSKVGLGHLI AKNEDEYVQL ALQLASDVTA LQNLRASLRD LMSKSPVCDG QNFISGLEAT    840
YRGMWRRYCK GDVPSSRYME MLKKEGVPEG VTNETSKPER VTMSKDTSSV SVESNGFNQA    900
PLSTPNLTTS EDNENQSSQT TNSGKLS*                                       960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3914Spy0.005352505172+
pfam13844Glyco_transf_413.0e-20487636153+
COG0457NrfG5.0e-22176450283+
pfam13844Glyco_transf_411.0e-24659845187+
COG3914Spy2.0e-95316848562+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtO82039019271932SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY
RefSeqXP_002281883.1019131911PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308458.1019271934predicted protein [Populus trichocarpa]
RefSeqXP_002323412.1019021907predicted protein [Populus trichocarpa]
RefSeqXP_002530535.1019271930o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1w3b_B1e-358944042378A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B6e-275537475380A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B8e-2421947462338A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B0.000000000000650271169386A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_A1e-358944042378A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2954084014298260
ES8419743086169230
HO7812093574968520
HO7812091183925090
HO781209692112770.0001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)