y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G241400.2
FamilyGH13
Protein PropertiesLength: 871 Molecular Weight: 99638 Isoelectric Point: 4.8926
ChromosomeChromosome/Scaffold: 02 Start: 60478914 End: 60489748
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133456652.5e-29
  LPRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGILVLMDIVHSHASNNVLDGLNMFDGTDGHYFHTGSRGHHSVWD
  SRLFNYGSWEVLRYLLSNARWWLEEYKFDGYRFDGVTSMMYIHHGLQVGFTGNYNEYFGYATDVDAVVYLMLVNDMIHGLYPEAVTIGEDVSGMPTFCIP
  VQDGGVGFDYRLHMAIADKWIEILKKRDEDWKMGEIVHTLTNRRWMEKCVAYAESHDQALVGDKTIAFWLMDKDMYEFMALDRPSTALIDRGIALHKMIR
  LVTMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 871     Download
MVYSVSDLRL PCSPSVYSFS QSSFNASRRS SSFSLLLKKD LFSRKIFAQK SSYDSDSSPL    60
TVASKKVLVP DDQGEGASSL TDELESPSTI SDDPQVIHDV ESEEMEDDTK IEVEEQESAP    120
KELSTPLKRK ISTEKSEAKP RTIPPPGIGQ KIYEIDPSLL DFRQHLDYRY AQYKRMREEI    180
DKYEGGLEVF SRGYEKLGFI GSEMGITYRE WAPGAKSAAL IGDFNNWNPN ADIMNRNEFG    240
VWEIFLPNNA DGSPAIPHGS RVKIRMETPS GIKDSIPAWI KFSVQAPGEI PYNGIYYDPP    300
EEEKYVFKHP RPQRPKSLRI YESHVGMSSP EPMINTYANF RDDVLPRIKR LGYNAVQIMA    360
IQEHSYYASF GYHVTNFFAP SSRFGTPDDL KSLIDKAHEL GILVLMDIVH SHASNNVLDG    420
LNMFDGTDGH YFHTGSRGHH SVWDSRLFNY GSWEVLRYLL SNARWWLEEY KFDGYRFDGV    480
TSMMYIHHGL QVGFTGNYNE YFGYATDVDA VVYLMLVNDM IHGLYPEAVT IGEDVSGMPT    540
FCIPVQDGGV GFDYRLHMAI ADKWIEILKK RDEDWKMGEI VHTLTNRRWM EKCVAYAESH    600
DQALVGDKTI AFWLMDKDMY EFMALDRPST ALIDRGIALH KMIRLVTMGL GGEGYLNFMG    660
NEFGHPEWID FPRGDQRLPN GVVIPGNGYS YDKCRRRFDL GDADYLRYRG MQEFDQAMQH    720
VEEKYGFMTS EHTYISRKDE KDRVIVFERG NLVFVFNFHW NNSYFDYRVG CAKPGKYKIV    780
LDSDDPLFGG FGRLDHNAEY FSFEGWFDDR PRSFMVYAPN RTAVVYALVE DEPKVVNDLE    840
LVEIPETVKP AAAEPVKESE PDEESEPLDS *                                   900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029606.0e-1016224691+
PLN03244PLN032444.0e-136254828583+
PLN02447PLN02447078838765+
cd11321AmyAc_bac_euk_BE0301716417+
PLN02960PLN029600254829580+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76444.1018551856starch branching enzyme II [Vigna radiata]
GenBankABN05322.1018321827starch branching enzyme II [Populus trichocarpa]
GenBankABO31358.1018341844starch branching enzyme II-1 [Malus x domestica]
DDBJBAA82348.2018551870starch branching enzyme [Phaseolus vulgaris]
RefSeqXP_002534111.1018402848starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A015283213696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A015283213696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B015283213696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A015283213696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3k1d_A09282431717A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945367101468500
HO7776386562008500
HO4581233954358290
HO4581233061384340
HO777638461552000.0000000009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)