y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G241400.5
FamilyGH13
Protein PropertiesLength: 767 Molecular Weight: 88282.5 Isoelectric Point: 5.0146
ChromosomeChromosome/Scaffold: 02 Start: 60479036 End: 60489562
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132415611.9e-29
  LPRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGILVLMDIVHSHASNNVLDGLNMFDGTDGHYFHTGSRGHHSVWD
  SRLFNYGSWEVLRYLLSNARWWLEEYKFDGYRFDGVTSMMYIHHGLQVGFTGNYNEYFGYATDVDAVVYLMLVNDMIHGLYPEAVTIGEDVSGMPTFCIP
  VQDGGVGFDYRLHMAIADKWIEILKKRDEDWKMGEIVHTLTNRRWMEKCVAYAESHDQALVGDKTIAFWLMDKDMYEFMALDRPSTALIDRGIALHKMIR
  LVTMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 767     Download
MEDDTKIEVE EQESAPKELS TPLKRKISTE KSEAKPRTIP PPGIGQKIYE IDPSLLDFRQ    60
HLDYRYAQYK RMREEIDKYE GGLEVFSRGY EKLGFIGSEM GITYREWAPG AKSAALIGDF    120
NNWNPNADIM NRNEFGVWEI FLPNNADGSP AIPHGSRVKI RMETPSGIKD SIPAWIKFSV    180
QAPGEIPYNG IYYDPPEEEK YVFKHPRPQR PKSLRIYESH VGMSSPEPMI NTYANFRDDV    240
LPRIKRLGYN AVQIMAIQEH SYYASFGYHV TNFFAPSSRF GTPDDLKSLI DKAHELGILV    300
LMDIVHSHAS NNVLDGLNMF DGTDGHYFHT GSRGHHSVWD SRLFNYGSWE VLRYLLSNAR    360
WWLEEYKFDG YRFDGVTSMM YIHHGLQVGF TGNYNEYFGY ATDVDAVVYL MLVNDMIHGL    420
YPEAVTIGED VSGMPTFCIP VQDGGVGFDY RLHMAIADKW IEILKKRDED WKMGEIVHTL    480
TNRRWMEKCV AYAESHDQAL VGDKTIAFWL MDKDMYEFMA LDRPSTALID RGIALHKMIR    540
LVTMGLGGEG YLNFMGNEFG HPEWIDFPRG DQRLPNGVVI PGNGYSYDKC RRRFDLGDAD    600
YLRYRGMQEF DQAMQHVEEK YGFMTSEHTY ISRKDEKDRV IVFERGNLVF VFNFHWNNSY    660
FDYRVGCAKP GKYKIVLDSD DPLFGGFGRL DHNAEYFSFE GWFDDRPRSF MVYAPNRTAV    720
VYALVEDEPK VVNDLELVEI PETVKPAAAE PVKESEPDEE SEPLDS*                  780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029606.0e-105814291+
PLN03244PLN032448.0e-137150724583+
PLN02447PLN02447012734729+
cd11321AmyAc_bac_euk_BE0197612417+
PLN02960PLN029600150725580+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76444.10175199856starch branching enzyme II [Vigna radiata]
GenBankABN05322.101728104827starch branching enzyme II [Populus trichocarpa]
DDBJBAA82348.20175199870starch branching enzyme [Phaseolus vulgaris]
RefSeqXP_002326414.1017281724predicted protein [Populus trichocarpa]
RefSeqXP_002534111.101736117848starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A04872813696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A04872813696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B04872813696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A04872813696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3k1d_A097720133717A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794536710427460
HO777638656967460
HO4581233953317250
HO458123306343300
HO7776384651960.0000000009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.4
Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)