y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G241400.7
FamilyGH13
Protein PropertiesLength: 638 Molecular Weight: 73469.9 Isoelectric Point: 5.1098
ChromosomeChromosome/Scaffold: 02 Start: 60482032 End: 60489605
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH131124326.2e-30
  LPRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGILVLMDIVHSHASNNVLDGLNMFDGTDGHYFHTGSRGHHSVWD
  SRLFNYGSWEVLRYLLSNARWWLEEYKFDGYRFDGVTSMMYIHHGLQVGFTGNYNEYFGYATDVDAVVYLMLVNDMIHGLYPEAVTIGEDVSGMPTFCIP
  VQDGGVGFDYRLHMAIADKWIEILKKRDEDWKMGEIVHTLTNRRWMEKCVAYAESHDQALVGDKTIAFWLMDKDMYEFMALDRPSTALIDRGIALHKMIR
  LVTMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 638     Download
MNRNEFGVWE IFLPNNADGS PAIPHGSRVK IRMETPSGIK DSIPAWIKFS VQAPGEIPYN    60
GIYYDPPEEE KYVFKHPRPQ RPKSLRIYES HVGMSSPEPM INTYANFRDD VLPRIKRLGY    120
NAVQIMAIQE HSYYASFGYH VTNFFAPSSR FGTPDDLKSL IDKAHELGIL VLMDIVHSHA    180
SNNVLDGLNM FDGTDGHYFH TGSRGHHSVW DSRLFNYGSW EVLRYLLSNA RWWLEEYKFD    240
GYRFDGVTSM MYIHHGLQVG FTGNYNEYFG YATDVDAVVY LMLVNDMIHG LYPEAVTIGE    300
DVSGMPTFCI PVQDGGVGFD YRLHMAIADK WIEILKKRDE DWKMGEIVHT LTNRRWMEKC    360
VAYAESHDQA LVGDKTIAFW LMDKDMYEFM ALDRPSTALI DRGIALHKMI RLVTMGLGGE    420
GYLNFMGNEF GHPEWIDFPR GDQRLPNGVV IPGNGYSYDK CRRRFDLGDA DYLRYRGMQE    480
FDQAMQHVEE KYGFMTSEHT YISRKDEKDR VIVFERGNLV FVFNFHWNNS YFDYRVGCAK    540
PGKYKIVLDS DDPLFGGFGR LDHNAEYFSF EGWFDDRPRS FMVYAPNRTA VVYALVEDEP    600
KVVNDLELVE IPETVKPAAA EPVKESEPDE ESEPLDS*                            660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0296GlgB5.0e-1001595600+
PLN03244PLN032446.0e-13921595583+
PLN02447PLN0244701605609+
cd11321AmyAc_bac_euk_BE068483417+
PLN02960PLN02960021596580+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76444.101622234856starch branching enzyme II [Vigna radiata]
GenBankACA35286.101604274877starch branching enzyme I [Cucumis sativus]
DDBJBAA82348.201622249870starch branching enzyme [Phaseolus vulgaris]
EMBLCAA56319.101635250887starch branching enzyme I [Pisum sativum]
RefSeqXP_002534111.101607242848starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0159995696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0159995696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0159995696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A0159995696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3k1d_A9.99995e-417591173717A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77763862216170
HO79453662216170
HO4581233952025960
HO45812320112010
HO61916762236100
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.6Gorai.002G241400.5Gorai.002G241400.4
Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)