y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.002G261700.4
FamilyGT4
Protein PropertiesLength: 373 Molecular Weight: 41886 Isoelectric Point: 10.1703
ChromosomeChromosome/Scaffold: 02 Start: 62223933 End: 62227756
Descriptionsulfoquinovosyldiacylglycerol 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT41653146.3e-38
  GEPERPLIIHVGRLGVEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFSGMPVVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPV
  VGARAGGVPDIIPADQEGKTGFLFNPGDLDDCLSKLKPLLQNKEMRETIG
Full Sequence
Protein Sequence     Length: 373     Download
MVVTTHEGVP TEFYGAKLIG SRSFPCPWYQ KVPLSLALSP RIISEVARFK PDIIHASSPG    60
IMVFGALIIA KLLCVPIVMS YHTHVPVYIP RYTFSWLVKP MWLVLKFLHR AADLTLVPSV    120
AIAKDLRAAR VTAANKIRLW NKGVDSESFH PRYRSHEMRL RLSNGEPERP LIIHVGRLGV    180
EKSLDFLKSV MDRLPEARIA FIGDGPYRED LEKLFSGMPV VFTGTLQGEE LSQAYASGDV    240
FVMPSESETL GLVVLEAMSS GIPVVGARAG GVPDIIPADQ EGKTGFLFNP GDLDDCLSKL    300
KPLLQNKEMR ETIGKAARQE MEKYDWRAAT KKIRNEQYNA AIWFWRKKRA QLLRPLQWLA    360
KRVFPSPKIS HR*                                                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like7.0e-5021341333+
cd03801GT1_YqgM_like2.0e-622334342+
TIGR00032argG2.0e-672325336+
TIGR00009L284.0e-1151329332+
PLN02871PLN0287101370370+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001058670.101370104474Os07g0100300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002278868.10137265436PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309122.10136866433predicted protein [Populus trichocarpa]
RefSeqXP_002323560.10136961429predicted protein [Populus trichocarpa]
RefSeqXP_002531354.10136466431glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L9e-16166321209365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K9e-16166321209365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J9e-16166321209365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I9e-16166321209365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H9e-16166321209365A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO813118319143320
DV711665301443440
DC885557287233090
EG473715299583560
DV105348278102870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00305.1Aquca_053_00022.3Aquca_053_00022.2Aquca_053_00022.1
Arabidopsis lyrata860579323188
Arabidopsis thalianaAT5G01220.1AT3G45100.2AT3G45100.1
Brachypodium distachyonBradi1g59860.1Bradi2g02800.1Bradi1g67200.1Bradi1g32610.1
Brassica rapaBra009633Bra005694Bra009589
Carica papayaevm.model.supercontig_163.3evm.model.supercontig_65.21
Capsella rubellaCarubv10000742mCarubv10019008m
Chlamydomonas reinhardtiiCre01.g038550.t1.3Cre16.g689150.t1.2Cre01.g006800.t1.3
Citrus clementinaCiclev10011473mCiclev10001141mCiclev10001076m
Citrus sinensisorange1.1g022615morange1.1g017114morange1.1g016648morange1.1g009759morange1.1g027511m
Cucumis sativusCucsa.176160.1Cucsa.143020.1
Eucalyptus grandisEucgr.A00516.1Eucgr.J00902.1
Fragaria vescamrna18817.1-v1.0-hybridmrna24819.1-v1.0-hybrid
Glycine maxGlyma03g14200.1Glyma01g27840.1Glyma18g42540.1Glyma07g17680.4Glyma07g17680.3
Glyma07g17680.2Glyma07g17680.1Glyma20g12140.9Glyma20g12140.8Glyma20g12140.7
Glyma20g12140.6Glyma20g12140.5Glyma20g12140.4Glyma20g12140.3Glyma20g12140.2
Glyma20g12140.10Glyma13g25060.1
Gossypium raimondiiGorai.012G112200.2Gorai.012G112200.1Gorai.002G261700.2Gorai.002G261700.6Gorai.002G261700.3
Gorai.002G261700.1Gorai.003G143800.9Gorai.003G143800.8Gorai.003G143800.7Gorai.003G143800.6
Gorai.003G143800.5Gorai.003G143800.4Gorai.003G143800.3Gorai.003G143800.2Gorai.003G143800.10
Gorai.003G143800.1
Linum usitatissimumLus10004832Lus10002499Lus10024892Lus10022925
Malus domesticaMDP0000899469MDP0000143617MDP0000297386MDP0000273680MDP0000203472
MDP0000184748MDP0000198677
Manihot esculentacassava4.1_007989mcassava4.1_005643mcassava4.1_032287m
Medicago truncatulaMedtr4g015260.1Medtr7g067340.1
Mimulus guttatusmgv1a004620mmgv1a004551mmgv1a006150mmgv1a006148m
Oryza sativaLOC_Os01g04920.1LOC_Os07g01030.1LOC_Os03g15840.1LOC_Os07g16960.1
Panicum virgatumPavirv00011082mPavirv00023556mPavirv00064963mPavirv00000330mPavirv00022111m
Pavirv00063251mPavirv00030308mPavirv00006595mPavirv00056553mPavirv00006877m
Physcomitrella patensPp1s24_194V6.1Pp1s106_103V6.1
Phaseolus vulgarisPhvul.010G005100.1Phvul.008G106900.1Phvul.005G132400.1Phvul.002G226400.1
Picea abiesMA_158718g0080MA_60607g0010MA_159042g1330MA_159118g0680MA_159090g0090
MA_159042g1140
Populus trichocarpaPotri.016G112600.4Potri.016G112600.3Potri.016G112600.2Potri.016G112600.1Potri.006G097600.3
Potri.006G097600.2Potri.006G097600.1Potri.016G130000.1
Prunus persicappa004263mppa005676mppa018035m
Ricinus communis35899.m00002429969.m00027234675.m00002848584.m00001330418.m000015
32791.m00002229638.m00053127698.m000067
Setaria italicaSi020690mSi001496mSi035897mSi035683m
Selaginella moellendorffii170091406541
Sorghum bicolorSb02g000240.1Sb03g006480.1Sb01g040150.1Sb02g008800.1
Thellungiella halophilaThhalv10013276mThhalv10002532m
Vitis viniferaGSVIVT01033998001GSVIVT01024777001
Volvox carteriVocar20009459mVocar20001320m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)