y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G030500.2
FamilyGH43
Protein PropertiesLength: 444 Molecular Weight: 50837.9 Isoelectric Point: 8.9723
ChromosomeChromosome/Scaffold: 03 Start: 2801053 End: 2803408
DescriptionArabinanase/levansucrase/invertase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431363589.4e-33
  SNTYYWYGEYKDGPTYRAYKRGAARVDVIGVGCYSSKDLWTWKNQGIVLAAEQTNETHDLHKSNVLERPKVVFNEKTGKYVMWMHIDDANYTKASVGIAI
  SDYPTGPFEYLHSQRPHGFDSRDMTIFKDDDGVVYLIYSSQDNSELHIGPLTSDYLDVQPDMRRILIGQHREAPALFKYQGTYYMITSGCTGWAPNEALA
  HAAESIMGPWETMGNPCIGGNKM
Full Sequence
Protein Sequence     Length: 444     Download
MVWSLVGLLL MLQLYSFASR RNVVRGDIQL HVSRHPLVRE LEQVEEENIQ VPPPKKKKSP    60
HAAKRRRKRS ATLIDEFLNE NSQIRHVFFP DMKSAVDPVK GVENGSHHYY PGKIWLDTEG    120
NPIQAHGGGM LYDERSNTYY WYGEYKDGPT YRAYKRGAAR VDVIGVGCYS SKDLWTWKNQ    180
GIVLAAEQTN ETHDLHKSNV LERPKVVFNE KTGKYVMWMH IDDANYTKAS VGIAISDYPT    240
GPFEYLHSQR PHGFDSRDMT IFKDDDGVVY LIYSSQDNSE LHIGPLTSDY LDVQPDMRRI    300
LIGQHREAPA LFKYQGTYYM ITSGCTGWAP NEALAHAAES IMGPWETMGN PCIGGNKMFR    360
LATFFAQSTF VVPLPGIPGS YIFMADRWNP AELRNSRYVW LPLIVGGPPD RPLEYNFGFP    420
PWPRVSIYWH KKWRLPSSWK VSK*                                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_25.0e-17168351203+
cd09004GH43_bXyl1.0e-17137350225+
cd08990GH43_AXH_like3.0e-19168349196+
cd08978GH_F6.0e-49137403278+
cd08985GH43_63.0e-127123403282+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19498.10144324465unknown [Glycine max]
EMBLCBI33680.103544326434unnamed protein product [Vitis vinifera]
RefSeqNP_190557.10143822460glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_201555.203043660466glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqXP_002525277.10144057496beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F011240345328A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3vt2_E011240345328A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3vt2_D011240345328A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3vt2_C011240345328A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3vt2_B011240345328A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533351064400
GO3743623451014400
EY7037302951204140
CO07170427212720
DW480361240723110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1Bradi2g50980.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1Phvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny