y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G041900.1
FamilyGH5
Protein PropertiesLength: 540 Molecular Weight: 60818.4 Isoelectric Point: 4.8611
ChromosomeChromosome/Scaffold: 03 Start: 5147737 End: 5152307
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52065142.10195e-44
  ANGYGHNKAKQVLEKHRNTFLNVGDFEFLYRHGINTVRIPVGWWIAYDPDPPAPFIGGTLEALDNAFSWAEDYSIKCIIDLHAAPGSQNGMEHSASRDGT
  TGWPTSSDYILQTLHVIDFLASRYAKHPAFLGIELLNEPSAAEVPLDMLVSYYKQGYEVVRKYSPSAYVIICQRIGSADPLELYQADIGSHNLVVDLHYY
  NLFDTFFVNLSAIDNIQFIYKSREAQLQALNGANGPLVFIGEWVNEWNVTSGSQSEYQDFGRAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLRL
  SSSEKKVFN
Full Sequence
Protein Sequence     Length: 540     Download
MELVFSKWVF VFSLCCWLIF SVAVAVEGVH GGSKVRGVNL GGWLVIEGWI KPSLFDGIPN    60
GDMLDGTQVQ FKSVTLQKYV SAESGGGMDI SVDRDDAYSW ETFTLWRVSE LEFQFRTTQG    120
QFLTCYGNGC SASATAKSAS STETFQIERN NNGKVHIKIK SGTYLQATMD NQLTADYPGT    180
PGWDDNAATF EMTIVANNLH GDYQLANGYG HNKAKQVLEK HRNTFLNVGD FEFLYRHGIN    240
TVRIPVGWWI AYDPDPPAPF IGGTLEALDN AFSWAEDYSI KCIIDLHAAP GSQNGMEHSA    300
SRDGTTGWPT SSDYILQTLH VIDFLASRYA KHPAFLGIEL LNEPSAAEVP LDMLVSYYKQ    360
GYEVVRKYSP SAYVIICQRI GSADPLELYQ ADIGSHNLVV DLHYYNLFDT FFVNLSAIDN    420
IQFIYKSREA QLQALNGANG PLVFIGEWVN EWNVTSGSQS EYQDFGRAQL EVYNAASFGW    480
AYWTLKNDRK HWDFEWNIRN NYLRLSSSEK KVFNSLRWLL LASICFYQCQ ILELVENWI*    540
                                                                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin0.00611517864+
cd00257Fascin4.0e-1067176110+
pfam00150Cellulase1.0e-16238488257+
COG2730BglC2.0e-23198501334+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI33153.10152760585unnamed protein product [Vitis vinifera]
RefSeqXP_002262875.10152748571PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310872.10355241492predicted protein [Populus trichocarpa]
RefSeqXP_002438060.1055249528hypothetical protein SORBIDRAFT_10g007500 [Sorghum bicolor]
RefSeqXP_002533566.10245326515conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3n9k_A4e-2520249550375A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB3n9k_A0.00635691448A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1eqp_A5e-2520240845252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqp_A0.0053569943A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqc_A9e-2520240845252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
Transmembrane Domains
StartEnd
931
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0872742961294240
JG8545172502144630
CO1143502381603970
CO12490324332450
JG854517264644894.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G044300.1
Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3Gorai.003G044000.2
Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)