y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G044000.3
FamilyGH5
Protein PropertiesLength: 459 Molecular Weight: 51484.1 Isoelectric Point: 4.6712
ChromosomeChromosome/Scaffold: 03 Start: 5657540 End: 5660500
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH51614452.8026e-45
  TNGYGPDKAPQVMQDHWNSYITEEDFNFMSANGLSAVRIPVGWWIAQDPTPPKPFVGGSSIALDNAFTWAEKYGMKVIIDLHAAKASQNGDEHSGARDGF
  LEWADSNIDETVAVIEFLAARYGVRPNLAAIALMNEPRAPGVTLDALTKYYKAAYDAIRKYTNAYVILSARLGPADPKELFSLASTMNRVAIDVHYYNLF
  SDSFSGMTVQQNIDFVNNQRASDLGSLTSANGPLVLVGEWTAEFARNDASMEDYQRFAKAQLDVYGRATFGWAYWAYNCDRNHWS
Full Sequence
Protein Sequence     Length: 459     Download
MVYLPFLLIF NLISYFPSSS HAQIADLILP LKAVNLGNWL VTEGWMKPSR FDGIINKDLL    60
LWRVSESCFN LRVFNKQFVG LGSQGVQAVL DTPTDTETFE IVRKDDDRNR VRFKASNGLF    120
LQAQSETLVT ADYAESSWDD SDPSVFIMTI VNTLQGEFQI TNGYGPDKAP QVMQDHWNSY    180
ITEEDFNFMS ANGLSAVRIP VGWWIAQDPT PPKPFVGGSS IALDNAFTWA EKYGMKVIID    240
LHAAKASQNG DEHSGARDGF LEWADSNIDE TVAVIEFLAA RYGVRPNLAA IALMNEPRAP    300
GVTLDALTKY YKAAYDAIRK YTNAYVILSA RLGPADPKEL FSLASTMNRV AIDVHYYNLF    360
SDSFSGMTVQ QNIDFVNNQR ASDLGSLTSA NGPLVLVGEW TAEFARNDAS MEDYQRFAKA    420
QLDVYGRATF GWAYWAYNCD RNHWSLKWMI ENNFIQLK*                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00150Cellulase3.0e-15176438279+
COG2730BglC1.0e-27165455332+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN74231.1025457137607hypothetical protein [Vitis vinifera]
EMBLCBI18831.1034576505unnamed protein product [Vitis vinifera]
EMBLCBI33033.1014574505unnamed protein product [Vitis vinifera]
EMBLCBI33035.1034376485unnamed protein product [Vitis vinifera]
RefSeqXP_002306319.10324551481predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A4e-2915745245375A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3n9k_A4e-2915745250380A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1eqc_A5e-2915745245375A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1cz1_A5e-2915745245375A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution
PDB2pb1_A6e-2915745251381A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0763842991314290
DW5151452981344310
ES8084813541034520
CO094620265933570
DC898905374854570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.2
Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)