y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G044200.1
FamilyGH5
Protein PropertiesLength: 507 Molecular Weight: 56905.8 Isoelectric Point: 6.1859
ChromosomeChromosome/Scaffold: 03 Start: 5682849 End: 5685203
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52204882.20004e-42
  VMQDHWDSYITEQDFNFMSSNGLDAVRVPVGWWIAQDPNPPRPFVGGSSRALDNAFTWAEKYGMKVIIDLHAVKDSQNGNDHSGTRDGFQEWGDSNIGET
  VAVIEYLAARYGGRLGLAAIELMNEPLAPGATFDALAKYYRAGYDAVRKHTDAYVILSARLGPADPQEFFSLASSMNRVGIDVHNYNLFSDMFSSMSVQQ
  NIDYIYNQRASDLGRLISANGPRVFVGEWTGEFGRNDASMEDYKRFARAQLDVYGPATFGWAYWTYKCV
Full Sequence
Protein Sequence     Length: 507     Download
MSKGGLNMVY LAFLLFFNLI SCFPSSSHAQ NANLNLPLRA VNLGNWLVTE GWMQPSRFDG    60
IVNKDLLDGT QVQFLSTRLN KYLCAESGGG TIIVANRASA SGWETFRLWR VNASYFNFRV    120
FFKQFVGLGN QGVVQAVLNG PTNSATFEIV RRNGDPNKVR LRASNGLFLQ AQSETRVTAD    180
YRGSSWDDWD PSVFRMTIVN TLQGEYQITN GYGPDRAPQV MQDHWDSYIT EQDFNFMSSN    240
GLDAVRVPVG WWIAQDPNPP RPFVGGSSRA LDNAFTWAEK YGMKVIIDLH AVKDSQNGND    300
HSGTRDGFQE WGDSNIGETV AVIEYLAARY GGRLGLAAIE LMNEPLAPGA TFDALAKYYR    360
AGYDAVRKHT DAYVILSARL GPADPQEFFS LASSMNRVGI DVHNYNLFSD MFSSMSVQQN    420
IDYIYNQRAS DLGRLISANG PRVFVGEWTG EFGRNDASME DYKRFARAQL DVYGPATFGW    480
AYWTYKCVYN HWSLKWMIEN NYINLN*                                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin0.000270180112+
pfam00150Cellulase6.0e-13224483271+
COG2730BglC2.0e-23213486310+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN74231.1036505141607hypothetical protein [Vitis vinifera]
EMBLCBI18831.101650513505unnamed protein product [Vitis vinifera]
EMBLCBI33033.101650513505unnamed protein product [Vitis vinifera]
EMBLCBI33035.101648613486unnamed protein product [Vitis vinifera]
RefSeqXP_002306319.10395031481predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A4e-3320548645360A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3n9k_A4e-3320548650365A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1eqc_A6e-3320548645360A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8989053711365050
CO0763842991794770
DW5151452961844790
ES805208301513510
CO085309269282960
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044000.3Gorai.003G044000.2
Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)