y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G044300.1
FamilyGH5
Protein PropertiesLength: 500 Molecular Weight: 56354.7 Isoelectric Point: 6.0207
ChromosomeChromosome/Scaffold: 03 Start: 5686168 End: 5688352
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52124830
  MQAHWDSYITEQDFKFISANGLSAVRIPVGWWIAQDPNPPKPFVGGSLKALDNAFTWAEKYGMKVIVDLHAAKASQNRFEHSGARDGFLEWGDSNIDETV
  AVIEFLATRYGGSPSLGAIELMNEPWAPDVTLDALTKYYKAGYDAIRKHTNAYVILSARLGPADPKELFSFARSLNRVAIDVHWYNLFTDMFITMTVQQN
  IDYIYDQRSSDLDSWISANGPPILIGEWTGEFGAKKGSLEDYKRYTKAELDVYGGATFGWAYWSYKCEENHW
Full Sequence
Protein Sequence     Length: 500     Download
MVYLAFLLFF NLISCFPPSH AQNTDLKLPL RAVNLGNWLV TEGWMKPSRF DGIINKDLLD    60
GAHVQFLSTK LNKFLCAENG GGTVLVANRI SPSDWETFRL WRVNESYFHL RVLNKQFVGL    120
GNQGVKAVSN TPTHSETFQI ARKDDAPNRV RLKASNGFFL QVQSETLVTA DYTGSSWDDS    180
DPSVFNIAIV NTLQGEYQIT NGYGPVKAPQ VMQAHWDSYI TEQDFKFISA NGLSAVRIPV    240
GWWIAQDPNP PKPFVGGSLK ALDNAFTWAE KYGMKVIVDL HAAKASQNRF EHSGARDGFL    300
EWGDSNIDET VAVIEFLATR YGGSPSLGAI ELMNEPWAPD VTLDALTKYY KAGYDAIRKH    360
TNAYVILSAR LGPADPKELF SFARSLNRVA IDVHWYNLFT DMFITMTVQQ NIDYIYDQRS    420
SDLDSWISAN GPPILIGEWT GEFGAKKGSL EDYKRYTKAE LDVYGGATFG WAYWSYKCEE    480
NHWSLKWMID NNFIQLNMR*                                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin4.0e-572171100+
pfam00150Cellulase5.0e-20212476271+
COG2730BglC1.0e-27213477300+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN74231.1025496138607hypothetical protein [Vitis vinifera]
EMBLCBI18831.1034966505unnamed protein product [Vitis vinifera]
EMBLCBI33033.1024965505unnamed protein product [Vitis vinifera]
EMBLCBI33035.10547712486unnamed protein product [Vitis vinifera]
RefSeqXP_002306319.10314941481predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A4e-3419648645370A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3n9k_A5e-3419647950367A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB2pc8_A7e-3419648651376A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
PDB2pbo_A7e-3419648651376A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8401682851814650
DC8989053741244960
ES805208300433420
CO0763842991704680
DW5151452961754700
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3Gorai.003G044000.2
Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)