y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G045100.1
FamilyAA1
Protein PropertiesLength: 586 Molecular Weight: 65669.6 Isoelectric Point: 7.8679
ChromosomeChromosome/Scaffold: 03 Start: 5899732 End: 5901790
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA13445645.04467e-44
  TTPPPPPLWNNTDPRLAQSHAIKARQGYIHTPPSRSDRVIVFLNTQNTINGNVRWSVNNVSFALPHTPYLIALKENLTHVFDQTPPPDGYDYQNYDIRIV
  QENRNATSSNGVYRLNFNSTVDIILQNANSMSLGTSETHPWHLHGHDFWVLGYGEGKFDMFNDPKKYNLVNPIMKNTVPVHPYGWTALRFRADNPGAWAF
  HCHIESHFYMGMGVVFAEGID
Full Sequence
Protein Sequence     Length: 586     Download
MIFSNMVLIP KCKSRVILFL WLLGITALLN GSAVEARIRR YKWEVKYEYK SPDCLKKLVI    60
TINGGTPGPT ITAQQNDTII VELTNGLLTE NVAIHWHGIR QIGTPWFDGT EGVTQCPILP    120
GTTFKYQFVV DRAGTYLYHA HYGMQREAGL YGSIIVGLPD GKSEPFTYDY DRNIILNDWY    180
HKSTYEQAAG LSAIPFQWVG EPQSLLIHGR GKFNCSTLTT PSLDAGICNA TNPDCEPFRL    240
IAVPGKTYRL RISSLTALSA LSFQIEGHNM TVVEADGHYV EPFVVQNLFL YSGETYSVLV    300
KADQDPTRNY WITSNIVGRS APNTPPGLGV FVYYPNHPRR SPPTTPPPPP LWNNTDPRLA    360
QSHAIKARQG YIHTPPSRSD RVIVFLNTQN TINGNVRWSV NNVSFALPHT PYLIALKENL    420
THVFDQTPPP DGYDYQNYDI RIVQENRNAT SSNGVYRLNF NSTVDIILQN ANSMSLGTSE    480
THPWHLHGHD FWVLGYGEGK FDMFNDPKKY NLVNPIMKNT VPVHPYGWTA LRFRADNPGA    540
WAFHCHIESH FYMGMGVVFA EGIDKVGKLP SSVMGCGETQ GLYRP*                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02168PLN021685.0e-5617554558+
TIGR03390ascorbOXfungal1.0e-7274562522+
PLN02604PLN02604016581566+
TIGR03388ascorbase038579544+
PLN02191PLN02191021580563+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAY47050.103358530578ascorbate oxidase [Solanum lycopersicum]
DDBJBAB86897.103058517567syringolide-induced protein B13-1-1 [Glycine max]
RefSeqXP_002306323.10185853570predicted protein [Populus trichocarpa]
RefSeqXP_002315068.1065851579predicted protein [Populus trichocarpa]
RefSeqXP_002528975.101958514576l-ascorbate oxidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0365791541A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1asq_A0365791541A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1asp_B0365791541A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1asp_A0365791541A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1aso_B0365791541A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT46613227112710
DT468935279903680
DT465027246132580
DT4661332203675860
DV7055153132545660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_041_00052.1.82.339Aquca_041_00052.1.82.339Aquca_014_00555.1.62.334Aquca_014_00555.1.62.334Aquca_076_00041.2
Aquca_076_00041.1Aquca_041_00052.1.322.551Aquca_041_00052.1.322.551Aquca_014_00555.1.293.531Aquca_014_00555.1.293.531
Arabidopsis lyrata327935489021.76.330489021.76.330489021.332.543489021.332.543
Arabidopsis thalianaAT4G39830.1AT5G21100.1AT5G21105.3.93.349AT5G21105.3.93.349AT5G21105.1.93.348
AT5G21105.1.93.348AT5G21105.2AT5G21105.1.351.561AT5G21105.1.351.561AT5G21105.3.351.538
AT5G21105.3.351.538
Brachypodium distachyonBradi4g28950.1.82.349Bradi4g28950.1.82.349Bradi4g34690.1.66.371Bradi4g34690.1.66.371Bradi1g37600.1.101.397
Bradi1g37600.1.101.397Bradi1g37620.1.24.213Bradi1g37620.1.24.213Bradi4g28950.1.336.556Bradi4g28950.1.336.556
Bradi1g37620.1.300.552Bradi1g37620.1.300.552Bradi1g37600.1.396.616Bradi1g37600.1.396.616Bradi4g34690.1.374.560
Bradi4g34690.1.374.560
Brassica rapaBra021239Bra002357.76.340Bra002357.76.340Bra020145.76.334Bra020145.76.334
Bra040902.79.327Bra040902.79.327Bra002355.79.329Bra002355.79.329Bra040902.333.545
Bra040902.333.545Bra002357.331.550Bra002357.331.550Bra020145.312.543Bra020145.312.543
Bra002355.333.550Bra002355.333.550Bra002356
Carica papayaevm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.329.574evm.model.supercontig_103.59.329.574
Capsella rubellaCarubv10003529mCarubv10004461mCarubv10000569m.76.336Carubv10000569m.76.336Carubv10000578m.78.329
Carubv10000578m.78.329Carubv10000578m.287.554Carubv10000578m.287.554Carubv10000569m.338.548Carubv10000569m.338.548
Chlamydomonas reinhardtiiCre01.g031500.t1.2Cre02.g098350.t1.3
Citrus clementinaCiclev10014733mCiclev10025235m.97.370Ciclev10025235m.97.370Ciclev10025235m.335.568Ciclev10025235m.335.568
Citrus sinensisorange1.1g008038morange1.1g007890m.97.371orange1.1g007890m.97.371orange1.1g012467morange1.1g013385m
orange1.1g016150morange1.1g016030morange1.1g007890m.335.568orange1.1g007890m.335.568
Cucumis sativusCucsa.142840.1Cucsa.142830.1Cucsa.104600.1.63.324Cucsa.104600.1.63.324Cucsa.142810.1.299.517
Cucsa.142810.1.299.517Cucsa.104600.1.292.531Cucsa.104600.1.292.531
Eucalyptus grandisEucgr.B03781.1Eucgr.J00632.1Eucgr.I00388.1.75.347Eucgr.I00388.1.75.347Eucgr.I00451.1.64.318
Eucgr.I00451.1.64.318Eucgr.I00386.1.71.301Eucgr.I00386.1.71.301Eucgr.G00738.1.40.302Eucgr.G00738.1.40.302
Eucgr.I00360.1Eucgr.G00745.1Eucgr.I00451.1.277.518Eucgr.I00451.1.277.518Eucgr.I00388.1.301.548
Eucgr.I00388.1.301.548Eucgr.I00383.1Eucgr.I00385.1Eucgr.I00386.1.256.483Eucgr.I00386.1.256.483
Eucgr.G00738.1.290.505Eucgr.G00738.1.290.505Eucgr.I00361.1Eucgr.I00361.2
Fragaria vescamrna18497.1-v1.0-hybridmrna31737.1-v1.0-hybridmrna11056.1-v1.0-hybridmrna11055.1-v1.0-hybridmrna00542.1-v1.0-hybrid
Glycine maxGlyma14g04530.1Glyma20g12220.1Glyma13g03650.1Glyma20g12150.1Glyma05g33470.1.88.358
Glyma05g33470.1.88.358Glyma08g14730.1.90.352Glyma08g14730.1.90.352Glyma05g33470.1.354.553Glyma05g33470.1.354.553
Glyma08g14730.1.349.552Glyma08g14730.1.349.552
Gossypium raimondiiGorai.004G227900.1Gorai.008G103600.1
Linum usitatissimumLus10009603Lus10016808Lus10000871.59.334Lus10000871.59.334Lus10022504.87.341
Lus10022504.87.341Lus10026753.80.305Lus10026753.80.305Lus10025538Lus10000871.318.529
Lus10000871.318.529Lus10026753.306.552Lus10026753.306.552Lus10022504.343.558Lus10022504.343.558
Malus domesticaMDP0000179298.35.319MDP0000179298.35.319MDP0000131142.89.323MDP0000131142.89.323MDP0000459146.40.262
MDP0000459146.40.262MDP0000125288.36.266MDP0000125288.36.266MDP0000125288.374.614MDP0000125288.374.614
MDP0000179298.298.525MDP0000179298.298.525MDP0000201304MDP0000568244MDP0000131142.325.559
MDP0000131142.325.559MDP0000459146.260.495MDP0000459146.260.495MDP0000920266.221.462MDP0000920266.221.462
Manihot esculentacassava4.1_029114m.82.347cassava4.1_029114m.82.347cassava4.1_003963m.155.371cassava4.1_003963m.155.371cassava4.1_004384m.36.226
cassava4.1_004384m.36.226cassava4.1_004384m.318.564cassava4.1_004384m.318.564cassava4.1_003963m.333.583cassava4.1_003963m.333.583
cassava4.1_029114m.300.548cassava4.1_029114m.300.548
Medicago truncatulaMedtr8g091390.1.86.341Medtr8g091390.1.86.341Medtr8g091390.1.315.552Medtr8g091390.1.315.552
Mimulus guttatusmgv1a003391m.33.225mgv1a003391m.33.225mgv1a003543mmgv1a003391m.335.562mgv1a003391m.335.562
mgv1a005649m.212.451mgv1a005649m.212.451
Oryza sativaLOC_Os06g37080.1LOC_Os09g20090.1.54.408LOC_Os09g20090.1.54.408LOC_Os09g32952.1LOC_Os06g37150.1.86.374
LOC_Os06g37150.1.86.374LOC_Os06g37150.1.379.598LOC_Os06g37150.1.379.598LOC_Os09g20090.1.316.555LOC_Os09g20090.1.316.555
Panicum virgatumPavirv00010476mPavirv00034691mPavirv00008852m.57.349Pavirv00008852m.57.349Pavirv00034692m
Pavirv00038723mPavirv00009193mPavirv00052126mPavirv00008852m.333.549Pavirv00008852m.333.549
Pavirv00027786mPavirv00058661m.257.479Pavirv00058661m.257.479
Physcomitrella patensPp1s308_11V6.1Pp1s1_590V6.1Pp1s144_8V6.1Pp1s194_194V6.1Pp1s60_109V6.1.84.354
Pp1s60_109V6.1.84.354Pp1s60_109V6.1.337.558Pp1s60_109V6.1.337.558
Phaseolus vulgarisPhvul.006G011700.1Phvul.006G011600.1Phvul.002G262200.1.79.351Phvul.002G262200.1.79.351Phvul.008G206900.1
Phvul.002G262200.1.338.549Phvul.002G262200.1.338.549
Picea abiesMA_19018g0010.88.322MA_19018g0010.88.322MA_10433807g0010MA_10431339g0010MA_10436713g0030.31.219
MA_10436713g0030.31.219MA_10436713g0030.228.409MA_10436713g0030.228.409MA_10436713g0010MA_19018g0010.319.548
MA_19018g0010.319.548MA_126229g0020MA_603008g0010.263.441MA_603008g0010.263.441MA_10128792g0010
Populus trichocarpaPotri.010G171700.1Potri.009G159700.1Potri.T079500.1Potri.005G079400.1.87.361Potri.005G079400.1.87.361
Potri.T079700.1.75.347Potri.T079700.1.75.347Potri.009G159700.2Potri.001G219300.2Potri.001G454700.1.90.354
Potri.001G454700.1.90.354Potri.007G088300.1Potri.001G219300.1Potri.T079700.1.300.544Potri.T079700.1.300.544
Potri.001G454700.1.344.552Potri.001G454700.1.344.552Potri.005G079400.1.337.560Potri.005G079400.1.337.560
Prunus persicappa003375mppa003411mppa005837mppa021554m
Ricinus communis29877.m00046929708.m000190
Setaria italicaSi006138mSi032784m.54.346Si032784m.54.346Si029363m.78.344Si029363m.78.344
Si003983m.82.360Si003983m.82.360Si006071m.87.371Si006071m.87.371Si015580m
Si029363m.324.547Si029363m.324.547Si032784m.326.546Si032784m.326.546Si006071m.368.591
Si006071m.368.591Si003983m.367.550Si003983m.367.550
Selaginella moellendorffii104957.46.417104957.46.417104957.368.570104957.368.570
Sorghum bicolorSb10g022430.1Sb10g022440.1.81.467Sb10g022440.1.81.467Sb02g023150.1.78.337Sb02g023150.1.78.337
Sb02g023140.1.79.351Sb02g023140.1.79.351Sb02g023160.1.88.358Sb02g023160.1.88.358Sb03g001450.1.79.370
Sb03g001450.1.79.370Sb02g023140.1.313.549Sb02g023140.1.313.549Sb02g023150.1.315.550Sb02g023150.1.315.550
Sb02g023160.1.346.558Sb02g023160.1.346.558Sb10g022440.1.382.605Sb10g022440.1.382.605Sb03g001450.1.355.568
Sb03g001450.1.355.568
Thellungiella halophilaThhalv10013093mThhalv10013113m.18.207Thhalv10013113m.18.207Thhalv10013113m.307.543Thhalv10013113m.307.543
Vitis viniferaGSVIVT01037479001GSVIVT01022165001GSVIVT01022172001GSVIVT01022168001GSVIVT01022181001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)