y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G051800.1
FamilyGT1
Protein PropertiesLength: 454 Molecular Weight: 49463 Isoelectric Point: 6.2513
ChromosomeChromosome/Scaffold: 03 Start: 7799521 End: 7801491
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11914269.3e-36
  VLGNLESFFSRMLHRMGQVLPEATAVFLNSCEELDPDRTTDLKSKFKQYLNVGPFILATPPPSVPDPYGCLTWLDKQKPATVVYISFGSVVTPPPNELVA
  LAEAVEAIQVPFIWSLRDKSKVHLPNGFLERANGMVVPWAPQRDVLAHGAVGVFITHGGWNSLVESIAGGVPMIFRPFFGDHGVNGRMVEDVWEIGVIVE
  SGVLTKNGIMRGLDLILAQEKGKKMRENLKEVVALA
Full Sequence
Protein Sequence     Length: 454     Download
MSQLVDPHVA VLAFPRGTHA APLLAIIDRL ASASPKTLFS FFGTAQSNNS IFFSTSQPTP    60
PNVKAYNVDD GVPEGYVFVG KPQEDIELFM EVAPQNLRKA MELAVEESGR KVSCLVADAF    120
FWFAKQIAVE NGVPWVSFWT AGACSLSSHV YTDLIREKFG VGGIVGREDE TLNFIPGMSK    180
VRIRDLPEGI VLGNLESFFS RMLHRMGQVL PEATAVFLNS CEELDPDRTT DLKSKFKQYL    240
NVGPFILATP PPSVPDPYGC LTWLDKQKPA TVVYISFGSV VTPPPNELVA LAEAVEAIQV    300
PFIWSLRDKS KVHLPNGFLE RANGMVVPWA PQRDVLAHGA VGVFITHGGW NSLVESIAGG    360
VPMIFRPFFG DHGVNGRMVE DVWEIGVIVE SGVLTKNGIM RGLDLILAQE KGKKMRENLK    420
EVVALAQISV GANGSSTKNF KKLLDLVCSQ NHA*                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02173PLN021732.0e-398450471+
PLN02410PLN024101.0e-419440451+
PLN02555PLN025553.0e-437445483+
pfam00201UDPGT5.0e-4511414431+
PLN02448PLN024488.0e-488439466+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF59818.1014471450UDP-glucose:flavonoid 3-O-glucosyltransferase [Vitis vinifera]
GenBankABR24135.1014471450UDP-glucose: flavonoid 3-O-glucosyltransferase [Vitis labrusca]
DDBJBAB41020.1014471450UDP-glucose:flavonoid 3-O-glucosyltransferase [Vitis vinifera]
DDBJBAB41024.1014471450UDP-glucose:flavonoid 3-O-glucosyltransferase [Vitis vinifera]
RefSeqXP_002327314.10844710449UDP-glucose:flavonoid 3-o-glucosyltransferase [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A014471450A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2c1z_A014471450A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2c1x_A014471450A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A0844915454A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A0844915454A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO11757228612860
CO11731228522860
ES81113735213510
CO09529927812780
CO11807427432760
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1Gorai.010G063400.1
Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)