y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G059500.2
FamilyGH35
Protein PropertiesLength: 696 Molecular Weight: 77277.7 Isoelectric Point: 7.0646
ChromosomeChromosome/Scaffold: 03 Start: 10296576 End: 10301457
Descriptionbeta galactosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3531920
  KAQMRRFTKMIVNMMKAERLFESQGGPIILSQIENEYGPVEYEIGEPGKAYTDWAAKMAVRLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKP
  KMWTEAWTGWFTEFGGAVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHR
Full Sequence
Protein Sequence     Length: 696     Download
MMKAQMRRFT KMIVNMMKAE RLFESQGGPI ILSQIENEYG PVEYEIGEPG KAYTDWAAKM    60
AVRLGTGVPW VMCKQDDAPD PIINTCNGFY CDYFSPNKAY KPKMWTEAWT GWFTEFGGAV    120
PYRPAEDMAF SVARFIQKGG SFINYYMYHG GTNFGRTAGG PFIATSYDYD APLDEYGLLR    180
QPKWGHLKDL HRAIKLCESA LVSGDPTVMQ LGVHQEAHVF NYKSGGCAAF LANYDPKSFA    240
KVAFRDMHYN LPPWSISILP DCKNTVYNTA RVGAQIARKK MVPVPLHGGF SWQAYNEETA    300
SDADSSFTMV GLLEQINTTR DSTDYLWYTT DIEIDPNEEF FRNGKSPILT ILSAGHALHV    360
FVNGQLSGSS YGSLEFPKLT FSQGVNMRAG INKIALLSIA VGLPNVGPHF ETWNAGVLGP    420
VTLNGLNEGR RDLSWQKWSY KIGLKGEALN LHSLSGSSSV EWAEGSLVAQ RQPLTWYKTT    480
FNAPAGNAPL ALDMRSMGKG QIWINGQSIG RHWPAYKASG NCSVCNYAGT YDENKCRTNC    540
EEASQRWYHV PRSWLNPTGN LLVVIEEWGG DPNAISLVRR ETDSVCADIY EWQPTLMNYQ    600
MHASGKADKP LRPKVHLECD MGQKISAVKF VSFGTPEGVC GSYREGSCHA YHSYDAFNRL    660
CVGQNFCSVT VAPEMFGGDP CPNVMKKLSV EVICS*                              720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA0.00112184229+
pfam02140Gal_Lectin1.0e-1861769482+
pfam01301Glyco_hydro_351.0e-803194207+
PLN03059PLN0305903695694+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK96254.102695153846unknown [Populus trichocarpa x Populus deltoides]
EMBLCAC44500.102695150843beta-galactosidase [Fragaria x ananassa]
RefSeqXP_002327432.102695146839predicted protein [Populus trichocarpa]
RefSeqXP_002329051.104695139830predicted protein [Populus trichocarpa]
RefSeqXP_002527409.102695152845beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A0.00000000000000325190149325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B0.00000000727177145313A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B0.003322582382586A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A0.00000000727177145313A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO78060258825800
HO77816058125800
HO79555249624960
HO784793322183390
GW8689563152775910
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314Eucgr.A01181.1
Fragaria vescamrna15210.1-v1.0-hybrid
Glycine maxGlyma15g35931.1Glyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.003G059500.4Gorai.011G065300.5Gorai.003G059500.3Gorai.013G223000.1.124.295Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny