y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G059500.4
FamilyGH35
Protein PropertiesLength: 690 Molecular Weight: 76945.5 Isoelectric Point: 7.3799
ChromosomeChromosome/Scaffold: 03 Start: 10296576 End: 10301425
Descriptionbeta galactosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3511870
  MRRFTKMIVNMMKAERLFESQGGPIILSQIENEYGPVEYEIGEPGKAYTDWAAKMAVRLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMW
  TEAWTGWFTEFGGAVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHR
Full Sequence
Protein Sequence     Length: 690     Download
MRRFTKMIVN MMKAERLFES QGGPIILSQI ENEYGPVEYE IGEPGKAYTD WAAKMAVRLG    60
TGVPWVMCKQ DDAPDPIINT CNGFYCDYFS PNKAYKPKMW TEAWTGWFTE FGGAVPYRPA    120
EDMAFSVARF IQKGGSFINY YMYHGGTNFG RTAGGPFIAT SYDYDAPLDE YGLLRQPKWG    180
HLKDLHRAIK LCESALVSGD PTVMQLGVHQ EAHVFNYKSG GCAAFLANYD PKSFAKVAFR    240
DMHYNLPPWS ISILPDCKNT VYNTARVGAQ IARKKMVPVP LHGGFSWQAY NEETASDADS    300
SFTMVGLLEQ INTTRDSTDY LWYTTDIEID PNEEFFRNGK SPILTILSAG HALHVFVNGQ    360
LSGSSYGSLE FPKLTFSQGV NMRAGINKIA LLSIAVGLPN VGPHFETWNA GVLGPVTLNG    420
LNEGRRDLSW QKWSYKIGLK GEALNLHSLS GSSSVEWAEG SLVAQRQPLT WYKTTFNAPA    480
GNAPLALDMR SMGKGQIWIN GQSIGRHWPA YKASGNCSVC NYAGTYDENK CRTNCEEASQ    540
RWYHVPRSWL NPTGNLLVVI EEWGGDPNAI SLVRRETDSV CADIYEWQPT LMNYQMHASG    600
KADKPLRPKV HLECDMGQKI SAVKFVSFGT PEGVCGSYRE GSCHAYHSYD AFNRVCYICL    660
IAYMQVTRHL HLLAKLTLLH LHFSCCCLS*                                     720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA0.0027179215+
pfam02140Gal_Lectin0.00261265649+
pfam01301Glyco_hydro_351.0e-791189204+
PLN03059PLN0305901656657+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK96254.101656157812unknown [Populus trichocarpa x Populus deltoides]
EMBLCAC44500.101656154809beta-galactosidase [Fragaria x ananassa]
RefSeqXP_002327432.101656150805predicted protein [Populus trichocarpa]
RefSeqXP_002329051.101656141796predicted protein [Populus trichocarpa]
RefSeqXP_002527409.101656156811beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A0.00000000000000420185149325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B0.00000000622172145313A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B0.003317577382586A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A0.00000000622172145313A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO78060258415750
HO77816057715750
HO79555249214910
HO784793322133340
GW8689563152725860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314Eucgr.A01181.1
Fragaria vescamrna15210.1-v1.0-hybrid
Glycine maxGlyma15g35931.1Glyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.011G065300.5Gorai.003G059500.3Gorai.003G059500.2Gorai.013G223000.1.124.295Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny