y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G062300.1
FamilyGT57
Protein PropertiesLength: 513 Molecular Weight: 58559.4 Isoelectric Point: 9.0911
ChromosomeChromosome/Scaffold: 03 Start: 11356807 End: 11362010
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57245040
  ATIVKLLLIPSYHSTDLEVHRHWLAITHSLPLSQWYTDETSEWTLDYPPFFAYLERFLSMFAHLIDPQIVHLHHGLNYKANSAIYFQRMSVIVSDLFLLY
  GVYRSTLALASLKRNLIWLLVIWSPGLLIVDHLHFQYNGFLFGWLLLSLSFLAQGRDVMGGFLFAVLLCFKHLFAVAAPVYFVYLLRHYCRGGLVRGFAR
  LSVMGAIVVAVFAAAYGPFVYHGQIQQVIRRMFPFGRGLCHAYWAPNFWVFYIMLDKGIAFLLRKFGFNIPAPVASFTGGLVGDASPFAILPRVTPLTTF
  IMVLLALSPCLFRTWKDPRPRLIVRSVAYAYTCGFLFGWHVHEKASLHFSIPLAIVAVESLEDAKHYFLLSIVSCYSLFPLLYEAQEYPIKVLLLLLHTI
  LMWFSFSAQYSGSLRGDKKGGEKQGFEVGWVTKSYLIGVVVVEIWGQFLHPYLFGDKLPFVPLMLISMYCAIGILYSWIWQ
Full Sequence
Protein Sequence     Length: 513     Download
MMEMQESPQT PLVMAQLSWF FGIATIVKLL LIPSYHSTDL EVHRHWLAIT HSLPLSQWYT    60
DETSEWTLDY PPFFAYLERF LSMFAHLIDP QIVHLHHGLN YKANSAIYFQ RMSVIVSDLF    120
LLYGVYRSTL ALASLKRNLI WLLVIWSPGL LIVDHLHFQY NGFLFGWLLL SLSFLAQGRD    180
VMGGFLFAVL LCFKHLFAVA APVYFVYLLR HYCRGGLVRG FARLSVMGAI VVAVFAAAYG    240
PFVYHGQIQQ VIRRMFPFGR GLCHAYWAPN FWVFYIMLDK GIAFLLRKFG FNIPAPVASF    300
TGGLVGDASP FAILPRVTPL TTFIMVLLAL SPCLFRTWKD PRPRLIVRSV AYAYTCGFLF    360
GWHVHEKASL HFSIPLAIVA VESLEDAKHY FLLSIVSCYS LFPLLYEAQE YPIKVLLLLL    420
HTILMWFSFS AQYSGSLRGD KKGGEKQGFE VGWVTKSYLI GVVVVEIWGQ FLHPYLFGDK    480
LPFVPLMLIS MYCAIGILYS WIWQLKSILI SS*                                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg82.0e-11022503497+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI16712.1045121472unnamed protein product [Vitis vinifera]
RefSeqNP_181994.5025091505transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
Swiss-ProtO80505024101405ALG8_ARATH RecName: Full=Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase; AltName: Full=Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase; AltName: Full=Asparagine-linked glycosylation protein 8 homolog
RefSeqXP_002269114.1045121532PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002521523.101351214493dolichyl glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1234
107126
139158
186208
221243
258277
284306
316338
345364
415437
449471
481503
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY0984032992165110
ES8184462093055130
FG3446372431794210
HO0931951933215130
GT0409202932235090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00352.1
Arabidopsis lyrata903892
Arabidopsis thalianaAT2G44660.1
Brachypodium distachyonBradi3g52040.1
Brassica rapaBra004854
Carica papayaevm.model.supercontig_50.144
Capsella rubellaCarubv10023047m
Chlamydomonas reinhardtiiCre09.g414250.t1.3.19.125Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.19.125
Citrus clementinaCiclev10014906m
Citrus sinensisorange1.1g019776morange1.1g026008morange1.1g009885m
Cucumis sativusCucsa.362250.1
Eucalyptus grandisEucgr.E01703.1
Fragaria vescamrna03056.1-v1.0-hybrid
Glycine maxGlyma08g10420.1Glyma05g27431.2Glyma05g27431.1
Linum usitatissimumLus10043344Lus10019495
Malus domesticaMDP0000238047
Manihot esculentacassava4.1_005358m
Medicago truncatulaMedtr5g077540.1
Mimulus guttatusmgv1a004526m
Oryza sativaLOC_Os02g46320.1
Panicum virgatumPavirv00056060mPavirv00065643m
Physcomitrella patensPp1s34_140V6.1
Phaseolus vulgarisPhvul.007G221000.2Phvul.007G221000.1
Picea abiesMA_10429975g0010MA_7890741g0010
Populus trichocarpaPotri.014G053200.1
Prunus persicappa016151mppa004246m
Ricinus communis29634.m002078.26.16329634.m002078.26.16329634.m002078.164.48529634.m002078.164.485
Setaria italicaSi016919m
Selaginella moellendorffii45405.175.35645405.175.356
Sorghum bicolorSb04g031440.1
Thellungiella halophilaThhalv10001410m
Vitis viniferaGSVIVT01018341001
Volvox carteriVocar20011939m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny