y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G067900.1
FamilyCE8
Protein PropertiesLength: 539 Molecular Weight: 60050.8 Isoelectric Point: 8.3314
ChromosomeChromosome/Scaffold: 03 Start: 14188072 End: 14192905
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82265300
  DVTVCKNHRKCYKTVQEAVDAAPKNKKGRDQYVIKIRKGVYEETVRVPFEKKNVVFLGEGMGKTIITGALNVHQPGMNTYNSATVGVLGDGFMASGLTIR
  NTAGSDAHQAVAFRSDSDHSVIENCEFLGNQDTLYAQSLRQFYKNCRIQGNVDFIFGNSASVFQDCEILVGPRQTNPESSENNAVTAHGRTDPAQSTGLV
  FHNCVINGTEEYMRYYKKNPEVHKNYLGRPWKEYSRTIFINCKLEKIISPDGWMPWSGDVGLKTVFYGEFRNSGPGSDVSKRVPWSTQIPSQNVPTYSVQ
  NFIQG
Full Sequence
Protein Sequence     Length: 539     Download
MSIVHIFLPV SLVIFLAIFS SAHHDHEKST PSQMYHACQA TRFPELCETS LTQLSHLPPN    60
TTSLQIIQST ISVSDHNLKT GQSMVKSVLD TSKGNLNRTN IATICLDILS YSSYRIKSAH    120
YALTHGNIKD ARAWMSAALG YQQNCWGALK YVNDTKLVVD TMLFLDSLVH HSSNALSMMV    180
AYDNYGEDTT VWTPPKTERD GFYEKGSGGK LELRFNGGFP SNLKVDVTVC KNHRKCYKTV    240
QEAVDAAPKN KKGRDQYVIK IRKGVYEETV RVPFEKKNVV FLGEGMGKTI ITGALNVHQP    300
GMNTYNSATV GVLGDGFMAS GLTIRNTAGS DAHQAVAFRS DSDHSVIENC EFLGNQDTLY    360
AQSLRQFYKN CRIQGNVDFI FGNSASVFQD CEILVGPRQT NPESSENNAV TAHGRTDPAQ    420
STGLVFHNCV INGTEEYMRY YKKNPEVHKN YLGRPWKEYS RTIFINCKLE KIISPDGWMP    480
WSGDVGLKTV FYGEFRNSGP GSDVSKRVPW STQIPSQNVP TYSVQNFIQG DQWIPKSH*     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02745PLN027452.0e-10338534533+
PLN02301PLN023018.0e-1111534565+
PLN02713PLN027137.0e-1121537574+
pfam01095Pectinesterase1.0e-150226531309+
PLN02708PLN0270801538554+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196538.102953740550pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002281640.102953746554PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306241.102953748557predicted protein [Populus trichocarpa]
RefSeqXP_002309906.102953751563predicted protein [Populus trichocarpa]
RefSeqXP_002517239.102953741551Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02215343308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02265344304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B1e-212275358339B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A1e-212275358339B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B1e-212275358339B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX6715762752605340
ES7918892642745370
DT5713562682294950
ES8229563681094650
DW0942422792184950
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)