y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G075200.1
FamilyGH37
Protein PropertiesLength: 601 Molecular Weight: 68493.9 Isoelectric Point: 6.2892
ChromosomeChromosome/Scaffold: 03 Start: 18131026 End: 18134245
Descriptiontrehalase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37765880
  DPKHYVDLSLKSNLSTTVEAFDKLPKTENGSVSVKDFEGFIGKYFNDAGDDVVYAEPVDFVPEPHGFLPKVENPEVRGWALEVHALWKNFSRKVSSSVLH
  HPELHTLLPLPRPVIIPGSRFTEVYYWDSYWVIRGLLASKMYETAKAIVTNLIFMLDTYGHVLNGARAYYTNRSQPPLLSAMVYEIYNRTGDVEFVKKSL
  PPLIKEYRYWNSDIHELIIRDAEQCNHFLNRYYAMWNKPRPESSTIDEELASKFLNDSEKQQFYRELASTAESGWDFSTRWMRNSSDFTTLSTTTILPVD
  LNIFILRMELDIAFLAKTVGENAITEDFLRASQKRQKAFSAIFWNENMGQWLDYWLNNGADCEEPQTWKAENQNQKVFASNFVPLWIDLFNSDIHLVEKV
  TKSLKNSGLLCAAGIATSLTNSGQQWDFPNGWAPLQHMIVEGLSKSASMEARTVAKDIAERWIKTNYVAYKKTGAMHEKYDVEKCGEFGGGGEYTPQTGF
  GWSNGVVLAFLEE
Full Sequence
Protein Sequence     Length: 601     Download
MAPFLYHTYR KRHFLFLFSV FILSQSLPPM ALTNPLSPPS SCTKGPGPVI PVTPLLSFLV    60
RVQETALQTY GKSNFDPKHY VDLSLKSNLS TTVEAFDKLP KTENGSVSVK DFEGFIGKYF    120
NDAGDDVVYA EPVDFVPEPH GFLPKVENPE VRGWALEVHA LWKNFSRKVS SSVLHHPELH    180
TLLPLPRPVI IPGSRFTEVY YWDSYWVIRG LLASKMYETA KAIVTNLIFM LDTYGHVLNG    240
ARAYYTNRSQ PPLLSAMVYE IYNRTGDVEF VKKSLPPLIK EYRYWNSDIH ELIIRDAEQC    300
NHFLNRYYAM WNKPRPESST IDEELASKFL NDSEKQQFYR ELASTAESGW DFSTRWMRNS    360
SDFTTLSTTT ILPVDLNIFI LRMELDIAFL AKTVGENAIT EDFLRASQKR QKAFSAIFWN    420
ENMGQWLDYW LNNGADCEEP QTWKAENQNQ KVFASNFVPL WIDLFNSDIH LVEKVTKSLK    480
NSGLLCAAGI ATSLTNSGQQ WDFPNGWAPL QHMIVEGLSK SASMEARTVA KDIAERWIKT    540
NYVAYKKTGA MHEKYDVEKC GEFGGGGEYT PQTGFGWSNG VVLAFLEEFG WPKDKKIDCD    600
*                                                                    660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13272treA2.0e-8223590580+
PRK13271treA4.0e-87187598418+
COG1626TreA2.0e-97140590467+
PLN02567PLN02567049599554+
pfam01204Trehalase072590526+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002263698.10405998564PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303674.10305991568predicted protein [Populus trichocarpa]
RefSeqXP_002303675.10305991568predicted protein [Populus trichocarpa]
RefSeqXP_002518875.10305991567alpha,alpha-trehalase, putative [Ricinus communis]
RefSeqXP_002523413.104959916566alpha,alpha-trehalase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D012159854510A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2wyn_C012159854510A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2wyn_B012159854510A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2wyn_A012159854510A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2jjb_D012159854510A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
Transmembrane Domains
StartEnd
1332
Signal Peptide
Cleavage Site
33
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT571282296343290
DT4646192613265860
CO0956762312735030
DT4646182323215520
CO095676202522711.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny